4IGT: GluA2 ligand-binding domain

Crystal structure of the GluA2 ligand-binding domain (S1S2J) in complex with the agonist ZA302 at 1.24A resolution. Determined by X-ray diffraction at 1.24 Å resolution. Released 6 Mar 2013.

Method: X-ray diffraction
Resolution: 1.24 Å
Organism: Rattus norvegicus
Chains: 1
Atoms: 2,556
Mol. weight: 30.13 kDa
Ligands: LI, 3ZA
Released: 6 Mar 2013

Explore 4IGT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4IGT contains 15 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	416-420	5	1
β-strand	423	1	2
β-strand	427	1	2
β-strand	428-429	2	3
α-helix	433-435	3
α-helix	438-441	4
β-strand	442-443	2	3
α-helix	445-457	13
β-strand	461-465	5	1
β-strand	474	1	4
β-strand	481	1	4
α-helix	483-489	7
β-strand	495-496	2	1
β-strand	501	1	5
α-helix	504-507	4
β-strand	510-512	3	1
α-helix	513	1
α-helix	515	1
β-strand	517-519	3	5
β-strand	521-526	6	6
α-helix	657-661	5
β-strand	667-669	3	6
β-strand	671	1	7
α-helix	675-682	8
α-helix	686-697	12
β-strand	704	1	7
α-helix	707-716	10
β-strand	721-726	6	6
α-helix	727-734	8
β-strand	741-744	4	6
β-strand	751-753	3	5
β-strand	756-758	3	1
α-helix	763-776	14
α-helix	779-784	6
α-helix	785-790	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glutamate receptor 2	A	protein	263	Rattus norvegicus	P19491 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4IGT_1 Glutamate receptor 2 (chains A)
GANKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGK
YGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTP
IESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVAR
VRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLK
LNEQGLLDKLKNKWWYDKGECGS

Ligands and cofactors

ID	Name	Formula	Copies
LI	Lithium ion	Li	1
3ZA	(4R)-4-{3-[hydroxy(methyl)amino]-3-oxopropyl}-L-glutamic acid	C9 H16 N2 O6	1

Water and common crystallization additives (GOL, SO4) are not listed.

Primary citation

Chemoenzymatic synthesis of new 2,4-syn-functionalized (S)-glutamate analogues and structure-activity relationship studies at ionotropic glutamate receptors and excitatory amino acid transporters. Assaf, Z., Larsen, A.P., Venskutonyte, R. et al. J Med Chem (2013) 56:1614-1628. DOI 10.1021/jm301433m · PubMed

Other PDB entries of the same protein (UniProt P19491 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YK4 1.0 Å, Structure of the AMPA receptor GluA2o ligand-binding domain (S1S2J) in complex with the…
5NG9 1.15 Å, Crystal structure of the GluA2 ligand-binding domain (S1S2J) in complex with agonist…
6YK5 1.15 Å, Structure of the AMPA receptor GluA2o ligand-binding domain (S1S2J) in complex with the…
6YK3 1.2 Å, Structure of the AMPA receptor GluA2o ligand-binding domain (S1S2J) in complex with the…
5JEI 1.23 Å, Crystal structure of the GluA2 LBD in complex with FW
4YU0 1.26 Å, Crystal structure of a tetramer of GluA2 TR mutant ligand binding domains bound with…
5NIH 1.3 Å, Crystal structure of the GluA2 ligand-binding domain (S1S2J) in complex with agonist…
1MQI 1.35 Å, Crystal Structure of the GluR2 Ligand Binding Core (S1S2J) in Complex with…
5FTI 1.35 Å, Crystal structure of the GluA2 K738M-T744K LBD in complex with glutamate (lithium form)
4U21 1.39 Å, GluA2flip sLBD complexed with FW and (R,R)-2b crystal form E
4FAT 1.4 Å, Ligand-binding domain of GluA2 (flip) ionotropic glutamate receptor in complex with an…
6FAZ 1.4 Å, Crystal structure of the GluA2 ligand-binding domain (S1S2J) in complex with the…

Browse structure collections

About this viewer

MolViewer shows 4IGT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.