Crystal structure of the Zaire ebolavirus VP35 interferon inhibitory domain K222A/R225A/K248A/K251A mutant. Determined by X-ray diffraction at 2.51 Å resolution. Released 9 Oct 2013.
Explore 4IJF in 3D Show helices and sheets RCSB PDB PDBe
4IJF contains 9 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 221-229 | 9 | |
| α-helix | 238-251 | 14 | |
| α-helix | 256-265 | 10 | |
| α-helix | 273-283 | 11 | |
| α-helix | 285-287 | 3 | |
| α-helix | 290-293 | 4 | |
| β-strand | 294-296 | 3 | 1 |
| α-helix | 300-302 | 3 | |
| α-helix | 305-310 | 6 | |
| β-strand | 311-312 | 2 | 1 |
| α-helix | 320-322 | 3 | |
| β-strand | 324-329 | 6 | 1 |
| β-strand | 335-339 | 5 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Polymerase cofactor VP35 | A | protein | 128 | Zaire ebolavirus | Q05127 (AlphaFold model) |
>4IJF_1 Polymerase cofactor VP35 (chains A) GHMGKDISAADLANIMYDHLPGFGTAFHQLVQVICALGADSNSLDIIHAEFQASLAEGDS PQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQD GKTLGLKI
Development of RNA Aptamers Targeting Ebola Virus VP35. Binning, J.M., Wang, T., Luthra, P. et al. Biochemistry (2013) 52:8406-8419. DOI 10.1021/bi400704d · PubMed
Other PDB entries of the same protein (UniProt Q05127 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4IJF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.