Structure of Tank-Binding Kinase 1. Determined by X-ray diffraction at 3.34 Å resolution. Released 6 Mar 2013.
Explore 4IM3 in 3D Show helices and sheets RCSB PDB PDBe
4IM3 contains 25 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1-3 | 3 | 1 |
| β-strand | 7-10 | 4 | 1 |
| β-strand | 14-17 | 4 | 1 |
| β-strand | 21-28 | 8 | 1 |
| β-strand | 34-40 | 7 | 1 |
| α-helix | 50-61 | 12 | |
| β-strand | 67 | 1 | 2 |
| β-strand | 70-75 | 6 | 1 |
| β-strand | 82-86 | 5 | 1 |
| β-strand | 92-93 | 2 | 2 |
| α-helix | 94-99 | 6 | |
| α-helix | 101-103 | 3 | |
| β-strand | 104 | 1 | 3 |
| β-strand | 106 | 1 | 3 |
| α-helix | 109-128 | 20 | |
| β-strand | 141-145 | 5 | 2 |
| β-strand | 151-155 | 5 | 2 |
| α-helix | 201-216 | 16 | |
| β-strand | 221-222 | 2 | 4 |
| α-helix | 231-239 | 9 | |
| α-helix | 241-242 | 2 | |
| β-strand | 247-250 | 4 | 4 |
| β-strand | 257-260 | 4 | 4 |
| α-helix | 271-284 | 14 | |
| α-helix | 289-291 | 3 | |
| α-helix | 295-306 | 12 | |
| β-strand | 309-315 | 7 | 5 |
| β-strand | 320-326 | 7 | 5 |
| α-helix | 332-343 | 12 | |
| α-helix | 347-349 | 3 | |
| β-strand | 351-354 | 4 | 5 |
| β-strand | 357-358 | 2 | 5 |
| α-helix | 367-369 | 3 | |
| α-helix | 371-372 | 2 | |
| α-helix | 378 | 1 | |
| β-strand | 379-382 | 4 | 5 |
| α-helix | 398-402 | 5 | |
| α-helix | 408-470 | 63 | |
| α-helix | 473-479 | 7 | |
| α-helix | 493-526 | 34 | |
| α-helix | 536-539 | 4 | |
| α-helix | 544-546 | 3 | |
| α-helix | 548-571 | 24 | |
| α-helix | 577-600 | 24 | |
| α-helix | 601-606 | 6 | |
| α-helix | 607-644 | 38 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine/threonine-protein kinase TBK1 | A | protein | 663 | Homo sapiens | Q9UHD2 (AlphaFold model) |
>4IM3_1 Serine/threonine-protein kinase TBK1 (chains A) GSGSGSMQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMR EFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLI VLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLY GTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVM YKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWG FDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIY EGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASM AKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRN IEKTVKVYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLAD AWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHA TKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNEL QET
| ID | Name | Formula | Copies |
|---|---|---|---|
| HG | Mercury (II) ion | Hg | 5 |
| BX7 | N-(3-{[5-iodo-4-({3-[(thiophen-2-ylcarbonyl)amino]propyl}amino)pyrimidin-2-yl]a… | C23 H26 I N7 O2 S | 1 |
Water and common crystallization additives (CL) are not listed.
Structure and ubiquitination-dependent activation of TANK-binding kinase 1. Tu, D., Zhu, Z., Zhou, A.Y. et al. Cell Rep (2013) 3:747-758. DOI 10.1016/j.celrep.2013.01.033 · PubMed
Other PDB entries of the same protein (UniProt Q9UHD2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4IM3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.