4ISO: Matriptase

Crystal Structure of Matriptase in complex with its inhibitor HAI-1. Determined by X-ray diffraction at 2.01 Å resolution. Released 6 Mar 2013.

Method: X-ray diffraction
Resolution: 2.01 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,606
Mol. weight: 34.49 kDa
Ligands: GSH
Released: 6 Mar 2013

Explore 4ISO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ISO contains 15 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
α-helix	22-23	2
β-strand	30-35	6	3
β-strand	39-46	8	3
β-strand	51-54	4	3
α-helix	56-58	3
α-helix	61-63	3
β-strand	64-68	5	3
β-strand	72	1	4
β-strand	81-90	10	3
β-strand	104-108	5	3
α-helix	111-114	4
α-helix	120-121	2
β-strand	122	1	2
α-helix	123-125	3
β-strand	135-140	6	2
β-strand	154	1	4
α-helix	155	1
β-strand	156-162	7	2
α-helix	165-171	7
β-strand	180-184	5	2
β-strand	189	1	1
α-helix	197	1
β-strand	198-202	5	2
β-strand	207-215	9	2
β-strand	226-230	5	2
α-helix	232-234	3
α-helix	235-242	8

Chain B: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	246	1
α-helix	247-251	5
α-helix	253-254	2
β-strand	259	1	2
β-strand	263-269	7	5
β-strand	274-280	7	5
β-strand	290	1	5
α-helix	293-300	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Suppressor of tumorigenicity 14 protein	A	protein	241	Homo sapiens	Q9Y5Y6 (AlphaFold model)
Kunitz-type protease inhibitor 1	B	protein	60	Homo sapiens	O43278 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4ISO_1 Suppressor of tumorigenicity 14 protein (chains A)
VVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTA
FLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPD
ASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVIQQTTCENLLPQQITPRMMCVGFL
SGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTG
V

Sequence of entity 2 (B), FASTA

>4ISO_2 Kunitz-type protease inhibitor 1 (chains B)
QTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLREEECILACRGVQ

Ligands and cofactors

ID	Name	Formula	Copies
GSH	Glutathione	C10 H17 N3 O6 S	1

Water and common crystallization additives (GOL, PEG, PGE) are not listed.

Primary citation

Crystal structures of matriptase in complex with its inhibitor hepatocyte growth factor activator inhibitor-1. Zhao, B., Yuan, C., Li, R. et al. J Biol Chem (2013) 288:11155-11164. DOI 10.1074/jbc.M113.454611 · PubMed

Other PDB entries of the same protein (UniProt Q9Y5Y6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3NCL 1.19 Å, Crystal Structure of MT-SP1 bound to Benzamidine Phosphonate Inhibitor
3P8G 1.2 Å, Crystal Structure of MT-SP1 in complex with benzamidine
8G1W 1.2 Å, Crystal Structure Matriptase (C731S) in Complex with Inhibitor VD4162B
1EAX 1.3 Å, Crystal structure of MTSP1 (matriptase)
8G1V 1.35 Å, Crystal Structure Matriptase (C731S) in Complex with Inhibitor MM1132-2
4IS5 1.48 Å, Crystal Structure of the ligand-free inactive Matriptase
3NPS 1.5 Å, Crystal structure of membrane-type serine protease 1 (MT-SP1) in complex with the Fab…
6T9T 1.69 Å, Matriptase in complex with the synthetic inhibitor (S)-3-(3-(4-(3-(tert-butyl)ureido)pipe…
4JZ1 1.9 Å, Crystal Structure of Matriptase in complex with Inhibitor
4O9V 1.9 Å, Crystal structure of matriptase in complex with inhibitor
4R0I 1.9 Å, Crystal structure of matriptase in complex with inhibitor
6N4T 1.95 Å, Crystal structure of Matriptase1 in complex with a peptidomimetic benzothiazole

Browse structure collections

About this viewer

MolViewer shows 4ISO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.