4ITH: RIP1 kinase

Crystal structure of RIP1 kinase in complex with necrostatin-1 analog. Determined by X-ray diffraction at 2.25 Å resolution. Released 13 Mar 2013.

Method: X-ray diffraction
Resolution: 2.25 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,228
Mol. weight: 68.81 kDa
Ligands: RCM
Released: 13 Mar 2013

Explore 4ITH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ITH contains 29 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	11-12	2	1
α-helix	14-16	3
β-strand	17	1	2
β-strand	32-35	4	1
β-strand	36	1	2
β-strand	41-46	6	1
α-helix	58-68	11
β-strand	75	1	3
β-strand	78-84	7	1
β-strand	87-93	7	1
β-strand	99	1	3
α-helix	100-104	5
α-helix	112-131	20
α-helix	141-143	3
β-strand	144-146	3	3
β-strand	152-154	3	3
α-helix	164-167	4
α-helix	204-205	2
α-helix	207-223	17
α-helix	234-242	9
α-helix	249-251	3
α-helix	258-267	10
α-helix	272-274	3
α-helix	276-277	2
α-helix	278-292	15

Chain B: 15 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	10-12	3	4
α-helix	14-16	3
β-strand	17	1	4
β-strand	22	1	4
β-strand	31-36	6	4
β-strand	40-49	10	4
α-helix	57-68	12
β-strand	72	1	5
β-strand	75	1	5
β-strand	78-84	7	4
β-strand	87-93	7	4
β-strand	99	1	5
α-helix	100-104	5
α-helix	112-131	20
α-helix	141-143	3
β-strand	144-146	3	5
β-strand	152-154	3	5
α-helix	164-168	5
α-helix	189-191	3
α-helix	195-197	3
α-helix	207-223	17
α-helix	234-242	9
α-helix	249-251	3
α-helix	258-267	10
α-helix	272-274	3
α-helix	278-288	11
α-helix	289-293	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Receptor-interacting serine/threonine-protein kinase 1	A, B	protein	294	Homo sapiens	Q13546 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4ITH_1 Receptor-interacting serine/threonine-protein kinase 1 (chains A, B)
MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLAFHRTQGLMIMKTVYKGPNCIEHNEAL
LEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIIL
EIIEGMAYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVD
GTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAIAEQQLIMA
IKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLE

Ligands and cofactors

ID	Name	Formula	Copies
RCM	(5R)-5-[(7-chloro-1H-indol-3-yl)methyl]-3-methylimidazolidine-2,4-dione	C13 H12 Cl N3 O2	2

Water and common crystallization additives (IOD, NA) are not listed.

Primary citation

Structural Basis of RIP1 Inhibition by Necrostatins. Xie, T., Peng, W., Liu, Y. et al. Structure (2013) 21:493-499. DOI 10.1016/j.str.2013.01.016 · PubMed

Other PDB entries of the same protein (UniProt Q13546 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5ZMZ 1.4 Å, Amyloid core of RIP1
6AC5 1.45 Å, Crystal structure of RIPK1 death domain GlcNAcylated by EPEC effector NleB
4ITJ 1.8 Å, Crystal structure of RIP1 kinase in complex with necrostatin-4
6NW2 2.0 Å, Structure of human RIPK1 kinase domain in complex with compound 11
7FD0 2.0 Å, Crystal Structure of human RIPK1 kinase domain in complex with a novel inhibitor
24IB 2.05 Å, Crystal structure of human RIPK1 kinase domain in complex with compound HR10
9Q31 2.05 Å, RIP1 kinase domain in complex with GDC-8264
6NYH 2.1 Å, Structure of human RIPK1 kinase domain in complex with GNE684
9GTY 2.15 Å, RIPK1 in complex with AZ"320
7FCZ 2.21 Å, Crystal Structure of human RIPK1 kinase domain in complex with a novel inhibitor
5HX6 2.23 Å, Crystal structure of RIP1 kinase with a benzo[b][1,4]oxazepin-4-one
9GTG 2.25 Å, RIPK1 in complex with AZ"902

Browse structure collections

About this viewer

MolViewer shows 4ITH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.