4ITV: PDB entry 4ITV

Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form. Determined by X-ray diffraction at 3.6 Å resolution. Released 24 Jul 2013.

Method: X-ray diffraction
Resolution: 3.6 Å
Organisms: Streptomyces aureofaciens, Influenza A virus
Chains: 12
Atoms: 40,776
Mol. weight: 603.38 kDa
Released: 24 Jul 2013

Explore 4ITV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ITV contains 294 α-helices and 158 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
β-strand	11-16	6	1
β-strand	17-20	4	2
β-strand	25-29	5	2
α-helix	36-39	4
α-helix	40-48	9
β-strand	52-56	5	2
α-helix	57-58	2
α-helix	73-87	15
β-strand	92-97	6	2
α-helix	99-111	13
β-strand	116-122	7	2
β-strand	130	1	3
β-strand	140	1	3
α-helix	142-154	13
α-helix	156-167	12
α-helix	170-173	4
β-strand	174	1	4
β-strand	178	1	4
α-helix	180-192	13
α-helix	195-200	6
α-helix	201-204	4
α-helix	213-215	3
β-strand	220-225	6	2
α-helix	237-243	7
β-strand	248-252	5	2
α-helix	259-262	4
α-helix	264-295	32
α-helix	302-316	15
α-helix	322-330	9
α-helix	337-350	14
α-helix	357-358	2
β-strand	359	1	5
α-helix	360	1
α-helix	361-364	4
α-helix	373-387	15
α-helix	392-399	8
α-helix	404-415	12
α-helix	423-439	17

Chain B: 23 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	6
β-strand	11-16	6	6
β-strand	17-19	3	7
β-strand	25-29	5	7
α-helix	36-39	4
α-helix	40-48	9
β-strand	52-56	5	7
α-helix	57-58	2
α-helix	73-87	15
β-strand	92-97	6	7
α-helix	99-111	13
β-strand	116-122	7	7
β-strand	130	1	8
β-strand	140	1	8
α-helix	142-167	26
α-helix	170-173	4
β-strand	174	1	9
β-strand	178	1	9
α-helix	180-192	13
α-helix	195-200	6
α-helix	202-205	4
α-helix	213-215	3
β-strand	220-225	6	7
α-helix	233-243	11
β-strand	248-252	5	7
α-helix	259-262	4
α-helix	264-295	32
α-helix	302-316	15
α-helix	322-330	9
α-helix	337-350	14
α-helix	357-360	4
α-helix	361-364	4
α-helix	373-387	15
α-helix	392-399	8
α-helix	404-415	12
α-helix	423-439	17

Chain C: 24 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	10
β-strand	11-16	6	10
β-strand	17-20	4	11
β-strand	25-29	5	11
α-helix	36-39	4
α-helix	40-48	9
β-strand	52-56	5	11
α-helix	57-58	2
α-helix	73-87	15
β-strand	92-97	6	11
α-helix	100-111	12
β-strand	116-122	7	11
β-strand	130	1	12
β-strand	140	1	12
α-helix	142-154	13
α-helix	156-167	12
α-helix	170-173	4
β-strand	174	1	13
β-strand	178	1	13
α-helix	180-192	13
α-helix	195-200	6
α-helix	201-204	4
α-helix	213-215	3
β-strand	220-225	6	11
α-helix	237-243	7
β-strand	248-252	5	11
α-helix	259-262	4
α-helix	264-295	32
α-helix	302-316	15
α-helix	322-330	9
α-helix	337-350	14
α-helix	357-360	4
α-helix	361-364	4
α-helix	373-387	15
α-helix	392-399	8
α-helix	404-415	12
α-helix	423-437	15

Chain D: 25 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	14
β-strand	11-16	6	14
β-strand	17-20	4	15
β-strand	25-29	5	15
α-helix	36-39	4
α-helix	40-48	9
β-strand	52-56	5	15
α-helix	57-58	2
α-helix	73-87	15
β-strand	92-97	6	15
α-helix	99-111	13
β-strand	116-122	7	15
β-strand	130	1	16
β-strand	140	1	16
α-helix	142-167	26
α-helix	170-173	4
β-strand	174	1	17
β-strand	178	1	17
α-helix	180-192	13
α-helix	195-200	6
α-helix	201-204	4
α-helix	213-215	3
β-strand	220-225	6	15
α-helix	233	1
α-helix	234-238	5
α-helix	239-243	5
β-strand	248-252	5	15
α-helix	259-262	4
α-helix	264-295	32
α-helix	302-316	15
α-helix	322-330	9
α-helix	337-350	14
α-helix	357-360	4
α-helix	361-364	4
α-helix	373-387	15
α-helix	392-399	8
α-helix	404-415	12
α-helix	423-437	15

Chain E: 23 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	18
β-strand	11-16	6	18
β-strand	17-19	3	19
β-strand	25-29	5	19
α-helix	36-39	4
α-helix	40-48	9
β-strand	52-56	5	19
α-helix	57-58	2
α-helix	73-87	15
β-strand	92-97	6	19
α-helix	100-111	12
β-strand	116-122	7	19
β-strand	130	1	20
β-strand	140	1	20
α-helix	142-167	26
α-helix	170-173	4
β-strand	174	1	21
β-strand	178	1	21
α-helix	180-192	13
α-helix	195-200	6
α-helix	201-204	4
α-helix	213-215	3
β-strand	220-225	6	19
α-helix	233-243	11
β-strand	248-252	5	19
α-helix	259-262	4
α-helix	264-295	32
α-helix	302-316	15
α-helix	322-330	9
α-helix	337-350	14
α-helix	357-360	4
α-helix	361-364	4
α-helix	373-387	15
α-helix	392-399	8
α-helix	404-415	12
α-helix	423-437	15

Chain F: 25 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	22
β-strand	11-16	6	22
β-strand	17-19	3	23
β-strand	25-29	5	23
α-helix	36-39	4
α-helix	40-48	9
β-strand	52-56	5	23
α-helix	57-58	2
α-helix	73-86	14
β-strand	92-97	6	23
α-helix	100-111	12
β-strand	116-122	7	23
β-strand	130	1	24
β-strand	140	1	24
α-helix	142-167	26
α-helix	170-173	4
β-strand	174	1	25
β-strand	178	1	25
α-helix	180-192	13
α-helix	195-200	6
α-helix	201-204	4
α-helix	213-215	3
β-strand	220-225	6	23
α-helix	233	1
α-helix	234-238	5
α-helix	239-243	5
β-strand	248-252	5	23
α-helix	259-262	4
α-helix	264-295	32
α-helix	302-316	15
α-helix	322-330	9
α-helix	337-350	14
α-helix	357-360	4
α-helix	361-364	4
α-helix	373-387	15
α-helix	392-399	8
α-helix	404-415	12
α-helix	423-439	17

Chain G: 25 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	26
β-strand	12-16	5	26
β-strand	17-19	3	27
β-strand	25-29	5	27
α-helix	36-39	4
α-helix	40-48	9
β-strand	52-56	5	27
α-helix	57-58	2
α-helix	73-87	15
β-strand	92-97	6	27
α-helix	100-111	12
β-strand	116-122	7	27
β-strand	130	1	28
β-strand	140	1	28
α-helix	142-167	26
α-helix	170-173	4
β-strand	174	1	29
β-strand	178	1	29
α-helix	180-192	13
α-helix	195-200	6
α-helix	201-204	4
α-helix	213-215	3
β-strand	220-225	6	27
α-helix	233	1
α-helix	234-238	5
α-helix	239-243	5
β-strand	248-252	5	27
α-helix	259-262	4
α-helix	264-295	32
α-helix	302-316	15
α-helix	322-330	9
α-helix	337-350	14
α-helix	357-360	4
α-helix	361-364	4
α-helix	373-387	15
α-helix	392-399	8
α-helix	404-415	12
α-helix	423-437	15

Chain H: 24 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	30
β-strand	11-16	6	30
β-strand	17-20	4	31
β-strand	25-29	5	31
α-helix	36-39	4
α-helix	40-48	9
β-strand	52-56	5	31
α-helix	57-58	2
α-helix	73-87	15
β-strand	92-97	6	31
α-helix	99-111	13
β-strand	116-122	7	31
β-strand	130	1	32
β-strand	140	1	32
α-helix	142-154	13
α-helix	156-167	12
α-helix	170-173	4
β-strand	174	1	33
β-strand	178	1	33
α-helix	180-192	13
α-helix	195-200	6
α-helix	201-204	4
α-helix	213-215	3
β-strand	220-225	6	31
α-helix	233-243	11
β-strand	248-252	5	31
α-helix	259-262	4
α-helix	264-295	32
α-helix	302-316	15
α-helix	322-330	9
α-helix	337-350	14
α-helix	357-360	4
α-helix	361-364	4
α-helix	373-387	15
α-helix	392-399	8
α-helix	404-415	12
α-helix	423-437	15

4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Non-haem bromoperoxidase BPO-A2, Matrix protein 1	A, B, C, D, E, F, G, H, I, J, K, L	protein	456	Streptomyces aureofaciens, Influenza A virus	P03485 (AlphaFold model), P29715 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L), FASTA

>4ITV_1 Non-haem bromoperoxidase BPO-A2, Matrix protein 1 (chains A, B, C, D, E, F, G, H, I, J, K, L)
MPFITVGQENSTSIDLYYEDHGTGTPVVLIHGFPLSGHSWERQSAALLDAGYRVITYDRR
GFGQSSQPTTGYDYDTFAADLNTVLETLDLQDAVLVGFSMGTGEVARYVSSYGTARIAAV
AFLASLEPFLLKTDDNPDGAAPQEFFDGIVAAVKADRYAFYTGFFNDFYNLDENLGTRIS
EEAVRNSWNTAASGGFFAAAAAPTTWYTDFRADIPRIDVPALILHGTGDRTLPIENTARV
FHKALPSAEYVEVEGAPHGLLWTHAEEVNTALLAFLAKAQEAQKQKLLTEVETYVLSIIP
SGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQR
RRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMG
AVTTEVAFGLVCATCEQIADSQHRSHRQLEHHHHHH

Primary citation

Structure and flexibility of nanoscale protein cages designed by symmetric self-assembly. Lai, Y.T., Tsai, K.L., Sawaya, M.R. et al. J Am Chem Soc (2013) 135:7738-7743. DOI 10.1021/ja402277f · PubMed

Other PDB entries of the same protein (UniProt P03485 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2VLL 1.6 Å, The Structural Dynamics and Energetics of an Immunodominant T-cell Receptor are…
5TEZ 1.7 Å, TCR F50 recgonizing M1-HLA-A2
5ISZ 2.06 Å, Crystal structure of LS01-TCR/M1-HLA-A*02 complex
1AA7 2.08 Å, Influenza virus matrix protein crystal structure at PH 4.0
5CQE 2.1 Å, 2.1 Angstrom resolution crystal structure of matrix protein 1 (M1; residues 1-164) from…
5EUO 2.1 Å, PF6-M1-HLA-A2
1EA3 2.3 Å, Influenza virus M1 protein
2VLR 2.3 Å, The Structural Dynamics and Energetics of an Immunodominant T-cell Receptor are…
5JHD 2.46 Å, Crystal structure of LS10-TCR/M1-HLA-A*02 complex
1HHI 2.5 Å, The antigenic identity of peptide(slash)mhc complexes: a comparison of the conformation…
3VDX 3.0 Å, Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains
7JM3 3.4 Å, Full-length three-dimensional structure of the influenza A virus M1 protein and its…

Browse structure collections

About this viewer

MolViewer shows 4ITV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.