4IWO: Serine/threonine-protein kinase TBK1

Crystal structure and mechanism of activation of TBK1. Determined by X-ray diffraction at 2.61 Å resolution. Released 13 Mar 2013.

Method: X-ray diffraction
Resolution: 2.61 Å
Organism: Homo sapiens
Chains: 1
Atoms: 5,104
Mol. weight: 76.37 kDa
Ligands: 1H4
Released: 13 Mar 2013

Explore 4IWO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4IWO contains 22 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
β-strand	4	1	2
β-strand	7-17	11	1
β-strand	21-28	8	1
β-strand	34-40	7	1
α-helix	51-61	11
β-strand	67	1	3
β-strand	70-75	6	1
β-strand	76	1	2
β-strand	82-86	5	1
β-strand	93	1	3
α-helix	94-98	5
α-helix	101-103	3
α-helix	109-129	21
β-strand	141-145	5	3
β-strand	151-155	5	3
α-helix	177-179	3
α-helix	182-185	4
α-helix	201-216	16
β-strand	221-222	2	4
α-helix	229-231	3
α-helix	232-240	9
β-strand	247-249	3	4
β-strand	258-260	3	4
α-helix	271-283	13
α-helix	295-306	12
β-strand	309-315	7	5
β-strand	320-326	7	5
β-strand	331	1	6
α-helix	332-343	12
β-strand	351-354	4	5
β-strand	357-359	3	5
β-strand	366	1	6
α-helix	371-372	2
β-strand	379-382	4	5
α-helix	399-403	5
α-helix	408-480	73
α-helix	494-526	33
α-helix	535-540	6
α-helix	544-546	3
α-helix	548-572	25
α-helix	577-600	24
α-helix	601-606	6
α-helix	607-642	36

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase TBK1	A	protein	660	Homo sapiens	Q9UHD2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4IWO_1 Serine/threonine-protein kinase TBK1 (chains A)
GAMGQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFE
VLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLR
DVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVALYGTE
EYLHPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKI
ITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQ
FFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGR
RLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKA
ITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEK
TVKVYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWA
HQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKA
MTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQET

Ligands and cofactors

ID	Name	Formula	Copies
1H4	N-{3-[(5-cyclopropyl-2-{[3-(2-oxopyrrolidin-1-yl)phenyl]amino}pyrimidin-4-yl)am…	C25 H32 N6 O2	1

Primary citation

Crystal structure and mechanism of activation of TANK-binding kinase 1. Larabi, A., Devos, J.M., Ng, S.L. et al. Cell Rep (2013) 3:734-746. DOI 10.1016/j.celrep.2013.01.034 · PubMed

Other PDB entries of the same protein (UniProt Q9UHD2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5EP6 1.45 Å, The crystal structure of NAP1 in complex with TBK1
4EFO 1.77 Å, Crystal structure of the ubiquitin-like domain of human TBK1
4EUU 1.8 Å, Structure of BX-795 Complexed with Human TBK1 Kinase Domain Phosphorylated on Ser172
5EOF 2.05 Å, Crystal structure of OPTN NTD and TBK1 CTD complex
4IM0 2.4 Å, Structure of Tank-Binding Kinase 1
4IM2 2.5 Å, Structure of Tank-Binding Kinase 1
5EOA 2.5 Å, Crystal structure of OPTN E50K mutant and TBK1 complex
4EUT 2.6 Å, Structure of BX-795 Complexed with Unphosphorylated Human TBK1 Kinase-ULD Domain
6RSU 2.75 Å, TBK1 in complex with Inhibitor compound 35
4IWQ 3.0 Å, Crystal structure and mechanism of activation of TBK1
4IWP 3.06 Å, Crystal structure and mechanism of activation of TBK1
6RSR 3.15 Å, TBK1 in complex with compound 2

Browse structure collections

About this viewer

MolViewer shows 4IWO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.