4J1P: Bromodomain 2 of human brd2

X-ray crystal structure of bromodomain 2 of human brd2 in complex with rvx208 to 1.08 A resolution. Determined by X-ray diffraction at 1.08 Å resolution. Released 15 Jan 2014.

Method: X-ray diffraction
Resolution: 1.08 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,293
Mol. weight: 13.81 kDa
Ligands: 1K0
Released: 15 Jan 2014

Explore 4J1P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4J1P contains 9 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	344-361	18
α-helix	363-365	3
α-helix	366-369	4
α-helix	370-372	3
α-helix	378-381	4
α-helix	386-389	4
α-helix	396-404	9
α-helix	411-428	18
α-helix	434-451	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bromodomain containing 2, isoform CRA_a	A	protein	114	Homo sapiens	P25440 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4J1P_1 Bromodomain containing 2, isoform CRA_a (chains A)
SMGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKR
KMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD

Ligands and cofactors

ID	Name	Formula	Copies
1K0	2-[4-(2-hydroxyethoxy)-3,5-dimethylphenyl]-5,7-dimethoxyquinazolin-4(3H)-one	C20 H22 N2 O5	1

Water and common crystallization additives (EDO) are not listed.

Primary citation

RVX-208, an Inducer of ApoA-I in Humans, Is a BET Bromodomain Antagonist. McLure, K.G., Gesner, E.M., Tsujikawa, L. et al. PLoS One (2013) 8:e83190-e83190. DOI 10.1371/journal.pone.0083190 · PubMed

Other PDB entries of the same protein (UniProt P25440 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5IG6 0.91 Å, Ultra-high resolution crystal structure of second bromodomain of BRD2 in complex with…
5IBN 0.94 Å, Ultra high resolution crystal structure of the apo- form of second bromodomain of BRD2.
6DBC 1.05 Å, Second bromodomain of Human BRD2 with a Tetrahydroquinoline analogue
6DDJ 1.05 Å, Crystal Structure of the human BRD2 BD2 bromodimain in complex with a…
7VRM 1.1 Å, crystal structure of BRD2-BD2 in complex with purine derivative
6I80 1.14 Å, Crystal Structure of the second bromodomain of BRD2 in complex with RT53
7VRQ 1.15 Å, crystal structure of BRD2-BD2 in complex with purine derivative
24KK 1.2 Å, Crystal structure of the second bromodomain (BD2) of human BRD2 in complex with…
5O38 1.2 Å, Human Brd2(BD2) mutant in free form
5O3I 1.2 Å, Human Brd2(BD2) mutant in complex with AL-tBu
7USG 1.2 Å, BRD2-BD2 in complex with MDP5
7VS0 1.25 Å, crystal structure of BRD2-BD2 in complex with purine derivative

Browse structure collections

About this viewer

MolViewer shows 4J1P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.