4J5L: Cargo Binding Domain from Human Myosin Va

Structure of the Cargo Binding Domain from Human Myosin Va. Determined by X-ray diffraction at 2.2 Å resolution. Released 9 Oct 2013.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,944
Mol. weight: 93.67 kDa
Released: 9 Oct 2013

Explore 4J5L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4J5L contains 44 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	1477-1478	2	1
α-helix	1481-1483	3
α-helix	1484-1488	5
α-helix	1489-1493	5
α-helix	1500-1504	5
α-helix	1508-1522	15
α-helix	1526-1546	21
α-helix	1551-1570	20
α-helix	1575-1577	3
α-helix	1583-1586	4
β-strand	1593	1	2
α-helix	1596-1626	31
α-helix	1627-1631	5
α-helix	1661-1677	17
α-helix	1682-1706	25
α-helix	1708-1710	3
α-helix	1713-1732	20
α-helix	1742-1744	3
α-helix	1745-1753	9
α-helix	1761-1770	10
α-helix	1776-1785	10
α-helix	1794-1797	4
α-helix	1798-1807	10
β-strand	1813	1	3
α-helix	1825-1827	3
α-helix	1838-1840	3
β-strand	1853-1854	2	1

Chain B: 21 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	1477-1478	2	4
α-helix	1481-1483	3
α-helix	1484-1488	5
α-helix	1489-1493	5
α-helix	1508-1522	15
α-helix	1526-1547	22
α-helix	1551-1570	20
α-helix	1575-1577	3
α-helix	1583-1587	5
β-strand	1593	1	3
α-helix	1596-1626	31
α-helix	1627-1631	5
α-helix	1661-1677	17
α-helix	1682-1704	23
α-helix	1708-1710	3
α-helix	1713-1732	20
α-helix	1741-1744	4
α-helix	1745-1755	11
α-helix	1761-1770	10
α-helix	1776-1785	10
α-helix	1795-1797	3
α-helix	1798-1807	10
β-strand	1813	1	2
α-helix	1838-1840	3
β-strand	1853-1854	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Unconventional myosin-Va	A, B	protein	408	Homo sapiens	Q9Y4I1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4J5L_1 Unconventional myosin-Va (chains A, B)
MENISPGQIIDEPIRPVNIPRKEKDFQGMLEYKKEDEQKLVKNLILELKPRGVAVNLIPG
LPAYILFMCVRHADYLNDDQKVRSLLTSTINSIKKVLKKRGDDFETVSFWLSNTCRFLHC
LKQYSGEEGFMKHNTSRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVRVLENILQPMIVS
GMLEHETIQGVSGVKPTGLRKRTSSIADEGTYTLDSILRQLNSFHSVMCQHGMDPELIKQ
VVKQMFYIIGAITLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGAKETLEPL
IQAAQLLQVKKKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMR
LRDRKDSPQLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLGFISRV

Primary citation

Structural Insights into Functional Overlapping and Differentiation among Myosin V Motors. Nascimento, A.F., Trindade, D.M., Tonoli, C.C. et al. J Biol Chem (2013) 288:34131-34145. DOI 10.1074/jbc.M113.507202 · PubMed

Other PDB entries of the same protein (UniProt Q9Y4I1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LX2 1.5 Å, Crystal structure of Myo5a globular tail domain in complex with melanophilin GTBD
5JCY 1.8 Å, Spir2-GTBM bound to MyoVa-GTD
4D07 1.85 Å, DYNLL2 dynein light chain binds to an extended, unstructured linear motif of myosin 5a…
4LX1 1.87 Å, Crystal structure of Myo5a globular tail domain
5JCZ 2.06 Å, Rab11 bound to MyoVa-GTD
4LLI 2.2 Å, Crystal Structure of human Myosin 5a globular domain

Browse structure collections

About this viewer

MolViewer shows 4J5L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.