4LX1: Myo5a globular tail domain

Crystal structure of Myo5a globular tail domain. Determined by X-ray diffraction at 1.87 Å resolution. Released 20 Nov 2013.

Method: X-ray diffraction
Resolution: 1.87 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,780
Mol. weight: 90.94 kDa
Released: 20 Nov 2013

Explore 4LX1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LX1 contains 48 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	1475-1476	2	1
α-helix	1479-1481	3
α-helix	1482-1486	5
α-helix	1487-1491	5
α-helix	1498-1502	5
α-helix	1506-1520	15
α-helix	1524-1544	21
α-helix	1549-1568	20
α-helix	1573-1575	3
α-helix	1581-1584	4
β-strand	1591	1	2
α-helix	1594-1624	31
α-helix	1625-1629	5
α-helix	1659-1675	17
α-helix	1680-1704	25
α-helix	1706-1708	3
α-helix	1711-1730	20
α-helix	1738-1741	4
α-helix	1743-1753	11
α-helix	1759-1768	10
α-helix	1774-1783	10
α-helix	1792-1795	4
α-helix	1796-1805	10
β-strand	1811	1	3
α-helix	1823-1825	3
α-helix	1836-1838	3
α-helix	1843-1845	3
β-strand	1851-1852	2	1

Chain B: 24 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	1475-1476	2	4
α-helix	1479-1481	3
α-helix	1482-1486	5
α-helix	1487-1491	5
α-helix	1498-1502	5
α-helix	1506-1520	15
α-helix	1524-1545	22
α-helix	1549-1568	20
α-helix	1573-1575	3
α-helix	1581-1584	4
β-strand	1591	1	3
α-helix	1594-1624	31
α-helix	1625-1629	5
α-helix	1659-1675	17
α-helix	1680-1704	25
α-helix	1706-1708	3
α-helix	1711-1730	20
α-helix	1738-1741	4
α-helix	1743-1753	11
α-helix	1759-1768	10
α-helix	1774-1783	10
α-helix	1793-1795	3
α-helix	1796-1805	10
β-strand	1811	1	2
α-helix	1823-1825	3
α-helix	1836-1838	3
α-helix	1843-1845	3
β-strand	1851-1852	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Unconventional myosin-Va	A, B	protein	392	Homo sapiens	Q9Y4I1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4LX1_1 Unconventional myosin-Va (chains A, B)
VNIPRKEKDFQGMLEYKKEDEQKLVKNLILELKPRGVAVNLIPGLPAYILFMCVRHADYL
NDDQKVRSLLTSTINSIKKVLKKRGDDFETVSFWLSNTCRFLHCLKQYSGEEGFMKHNTS
RQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVRVLENILQPMIVSGMLEHETIQGVSGVKP
TGLRKRTSSIADEGTYTLDSILRQLNSFHSVMCQHGMDPELIKQVVKQMFYIIGAITLNN
LLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGAKETLEPLIQAAQLLQVKKKTDDD
AEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMRLRDRKDSPQLLMDAKH
IFPVTFPFNPSSLALETIQIPASLGLGFISRV

Primary citation

Structural basis of myosin V Rab GTPase-dependent cargo recognition. Pylypenko, O., Attanda, W., Gauquelin, C. et al. Proc Natl Acad Sci U S A (2013) 110:20443-20448. DOI 10.1073/pnas.1314329110 · PubMed

Other PDB entries of the same protein (UniProt Q9Y4I1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LX2 1.5 Å, Crystal structure of Myo5a globular tail domain in complex with melanophilin GTBD
5JCY 1.8 Å, Spir2-GTBM bound to MyoVa-GTD
4D07 1.85 Å, DYNLL2 dynein light chain binds to an extended, unstructured linear motif of myosin 5a…
5JCZ 2.06 Å, Rab11 bound to MyoVa-GTD
4J5L 2.2 Å, Structure of the Cargo Binding Domain from Human Myosin Va
4LLI 2.2 Å, Crystal Structure of human Myosin 5a globular domain

Browse structure collections

About this viewer

MolViewer shows 4LX1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.