Crystal structure of a fusion protein containing the NBD of Hsp70 and the middle domain of Hip. Determined by X-ray diffraction at 2.7 Å resolution. Released 3 Jul 2013.
Explore 4J8F in 3D Show helices and sheets RCSB PDB PDBe
4J8F contains 30 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-6 | 5 | |
| β-strand | 7-11 | 5 | 1 |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 25-28 | 4 | 1 |
| α-helix | 29-30 | 2 | |
| β-strand | 38-39 | 2 | 1 |
| β-strand | 42-44 | 3 | 2 |
| β-strand | 49-51 | 3 | 2 |
| α-helix | 53-57 | 5 | |
| α-helix | 59-61 | 3 | |
| α-helix | 63-65 | 3 | |
| β-strand | 66-67 | 2 | 2 |
| α-helix | 70-73 | 4 | |
| α-helix | 81-87 | 7 | |
| β-strand | 93-96 | 4 | 3 |
| β-strand | 101-107 | 7 | 3 |
| β-strand | 110-114 | 5 | 3 |
| α-helix | 116-135 | 20 | |
| β-strand | 141-146 | 6 | 1 |
| α-helix | 152-164 | 13 | |
| β-strand | 168-174 | 7 | 1 |
| α-helix | 175-182 | 8 | |
| β-strand | 193-200 | 8 | 4 |
| β-strand | 205-213 | 9 | 4 |
| β-strand | 216-225 | 10 | 4 |
| α-helix | 230-249 | 20 | |
| α-helix | 257-276 | 20 | |
| β-strand | 279-288 | 10 | 5 |
| β-strand | 291-298 | 8 | 5 |
| α-helix | 299-305 | 7 | |
| α-helix | 307-311 | 5 | |
| α-helix | 315-324 | 10 | |
| α-helix | 328-330 | 3 | |
| β-strand | 333-337 | 5 | 4 |
| α-helix | 339-342 | 4 | |
| α-helix | 344-353 | 10 | |
| α-helix | 357-359 | 3 | |
| β-strand | 360 | 1 | 4 |
| α-helix | 368-382 | 15 | |
| α-helix | 383-386 | 4 | |
| α-helix | 396-398 | 3 | |
| α-helix | 401-404 | 4 | |
| α-helix | 414-433 | 20 | |
| α-helix | 436-449 | 14 | |
| α-helix | 454-466 | 13 | |
| α-helix | 470-483 | 14 | |
| α-helix | 489-501 | 13 | |
| α-helix | 504-517 | 14 | |
| α-helix | 521-549 | 29 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Heat shock 70 kDa protein 1A/1B, Hsc70-interacting protein | A | protein | 561 | Homo sapiens, Rattus norvegicus | P0DMV9 (AlphaFold model) |
>4J8F_1 Heat shock 70 kDa protein 1A/1B, Hsc70-interacting protein (chains A) GAMDPEFMAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGD AAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKA FYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRII NEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDF DNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDF YTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDF FNGRDLNKSINPDEAVAYGAAVQAAILMGLESDLEIDNEGVIEADTDAPQEMGDENAEIT EAMMDEANEKKGAAIDALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAA IRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAARDLALACKLDYDEDASAMLREVQPR AQKIAEHRRKYERKREEREIK
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 1 |
| PO4 | Phosphate ion | O4 P | 1 |
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 1 |
Water and common crystallization additives (IOD) are not listed.
Structure and function of Hip, an attenuator of the Hsp70 chaperone cycle. Li, Z., Hartl, F.U., Bracher, A. Nat Struct Mol Biol (2013) 20:929-935. DOI 10.1038/nsmb.2608 · PubMed
Other PDB entries of the same protein (UniProt P0DMV9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4J8F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.