X-ray crystal structure of Y149A mutated Hsp72-NBD in complex with AMPPnP. Determined by X-ray diffraction at 1.7 Å resolution. Released 29 Jun 2022.
Explore 7F50 in 3D Show helices and sheets RCSB PDB PDBe
7F50 contains 18 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-11 | 5 | 1 |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 25-28 | 4 | 1 |
| α-helix | 29-30 | 2 | |
| β-strand | 38-39 | 2 | 1 |
| β-strand | 42-44 | 3 | 2 |
| β-strand | 49-51 | 3 | 2 |
| α-helix | 53-57 | 5 | |
| α-helix | 59-61 | 3 | |
| α-helix | 63-65 | 3 | |
| β-strand | 66-67 | 2 | 2 |
| α-helix | 70-72 | 3 | |
| α-helix | 81-87 | 7 | |
| β-strand | 93-97 | 5 | 3 |
| β-strand | 100-107 | 8 | 3 |
| β-strand | 110-114 | 5 | 3 |
| α-helix | 116-135 | 20 | |
| β-strand | 141-146 | 6 | 1 |
| α-helix | 152-164 | 13 | |
| β-strand | 168-174 | 7 | 1 |
| α-helix | 175-182 | 8 | |
| β-strand | 192-200 | 9 | 4 |
| β-strand | 205-213 | 9 | 4 |
| β-strand | 216-225 | 10 | 4 |
| α-helix | 230-249 | 20 | |
| α-helix | 257-273 | 17 | |
| β-strand | 279-288 | 10 | 5 |
| β-strand | 291-298 | 8 | 5 |
| α-helix | 299-312 | 14 | |
| α-helix | 314-324 | 11 | |
| α-helix | 328-330 | 3 | |
| β-strand | 333-337 | 5 | 4 |
| α-helix | 339-342 | 4 | |
| α-helix | 344-353 | 10 | |
| β-strand | 360 | 1 | 4 |
| α-helix | 365-367 | 3 | |
| α-helix | 368-380 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Heat shock 70 kDa protein 1B | A | protein | 386 | Homo sapiens | P0DMV9 (AlphaFold model) |
>7F50_1 Heat shock 70 kDa protein 1B (chains A) KAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALN PQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSM VLTKMKEIAEAYLGYPVTNAVITVPAAFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIA YGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFV EEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARF EELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKS INPDEAVAYGAAVQAAILLEHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| ANP | Phosphoaminophosphonic acid-adenylate ester | C10 H17 N6 O12 P3 | 1 |
| MG | Magnesium ion | Mg | 2 |
Water and common crystallization additives (CL) are not listed.
Neutron crystallographic analysis of the nucleotide-binding domain of Hsp72 in complex with ADP. Yokoyama, T., Fujii, S., Ostermann, A. et al. IUCrJ (2022) 9:562-572. DOI 10.1107/S2052252522006297
Other PDB entries of the same protein (UniProt P0DMV9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7F50 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.