4JB8: Caspase-7

Caspase-7 in Complex with DARPin C7_16. Determined by X-ray diffraction at 1.7 Å resolution. Released 21 Aug 2013.

Method: X-ray diffraction
Resolution: 1.7 Å
Organisms: Homo sapiens, synthetic construct
Chains: 3
Atoms: 3,364
Mol. weight: 50.38 kDa
Released: 21 Aug 2013

Explore 4JB8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JB8 contains 21 α-helices and 19 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	56-58	3
β-strand	59	1	1
β-strand	66	1	2
β-strand	68-74	7	3
α-helix	80-82	3
α-helix	84-86	3
α-helix	90-104	15
β-strand	106-112	7	3
α-helix	116-128	13
β-strand	134	1	2
β-strand	137-142	6	3
β-strand	145-146	2	4
β-strand	149-152	4	4
β-strand	155-158	4	4
α-helix	159-163	5
α-helix	164-166	3
α-helix	172-174	3
β-strand	179-184	6	3
β-strand	190	1	5
β-strand	192	1	6

Chain B: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	219-223	5	3
β-strand	229	1	5
β-strand	233-234	2	7
β-strand	238-239	2	7
α-helix	240-252	13
α-helix	258-272	15
α-helix	280-282	3
β-strand	286	1	6
β-strand	290-293	4	3
β-strand	298	1	1

Chain P: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	14-23	10
α-helix	27-35	9
α-helix	50-57	8
α-helix	60-68	9
α-helix	83-90	8
α-helix	93-101	9
α-helix	116-123	8
α-helix	126-134	9
α-helix	149-155	7
α-helix	159-169	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Caspase-7 subunit p20	A	protein	175	Homo sapiens	P55210 (AlphaFold model)
Caspase-7 subunit p11	B	protein	105	Homo sapiens	P55210 (AlphaFold model)
DARPin C7_16	P	protein	171	synthetic construct

Sequence of entity 1 (A), FASTA

>4JB8_1 Caspase-7 subunit p20 (chains A)
AKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTG
MGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLS
HGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQAD

Sequence of entity 2 (B), FASTA

>4JB8_2 Caspase-7 subunit p11 (chains B)
ANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVN
DRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQLEHHHHHH

Sequence of entity 3 (P), FASTA

>4JB8_3 DARPin C7_16 (chains P)
MRGSHHHHHHGSDLGKKLLDAASAGQDDEVRILMANGADVNASNQQGWTPLHATAEYGHL
EIVDVLLAYGADVNASDSYGSTPLHSAAWAGHLEIVDVLLAHGADVNASDNYGWTPLHLA
AHTGHLEIVDVLLANGADVNANNWWGKTPFDLAIDNGNEDIAEVLQKAAKL

Primary citation

Design, construction, and characterization of a second-generation DARPin library with reduced hydrophobicity. Seeger, M.A., Zbinden, R., Flutsch, A. et al. Protein Sci (2013) 22:1239-1257. DOI 10.1002/pro.2312 · PubMed

Other PDB entries of the same protein (UniProt P55210 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JR2 1.65 Å, Human procaspase-7/caspase-7 heterodimer bound to Ac-DEVD-CMK
2QL9 2.14 Å, Crystal Structure of Caspase-7 with inhibitor AC-DQMD-CHO
4JR1 2.15 Å, Human procaspase-7 bound to Ac-DEVD-CMK
5K20 2.2 Å, Caspase-7 S239E Phosphomimetic
2QLB 2.25 Å, Crystal Structure of caspase-7 with inhibitor AC-ESMD-CHO
4LSZ 2.26 Å, Caspase-7 in Complex with DARPin D7.18
4ZVR 2.3 Å, Caspase-7 Variant 4 (V4) with reprogrammed substrate specificity due to…
2QL5 2.34 Å, Crystal Structure of caspase-7 with inhibitor AC-DMQD-CHO
1F1J 2.35 Å, Crystal structure of caspase-7 in complex with acetyl-asp-glu-val-asp-cho
6CL2 2.35 Å, Caspase-7 in complex with Ac-ATS009-KE
1I4O 2.4 Å, Crystal structure of the xiap/caspase-7 complex
2QL7 2.4 Å, Crystal Structure of Caspase-7 with inhibitor AC-IEPD-CHO

Browse structure collections

About this viewer

MolViewer shows 4JB8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.