4JR2: Human procaspase-7/caspase-7 heterodimer

Human procaspase-7/caspase-7 heterodimer bound to Ac-DEVD-CMK. Determined by X-ray diffraction at 1.65 Å resolution. Released 8 May 2013.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,298
Mol. weight: 57.77 kDa
Released: 8 May 2013

Explore 4JR2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JR2 contains 20 α-helices and 38 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	59	1	1
β-strand	66	1	2
β-strand	68-74	7	3
α-helix	80-82	3
α-helix	84-86	3
α-helix	90-104	15
β-strand	106-112	7	3
α-helix	116-127	12
β-strand	134	1	2
β-strand	137-142	6	3
β-strand	145-146	2	4
β-strand	149-152	4	4
β-strand	155-158	4	4
α-helix	159-163	5
α-helix	164-166	3
α-helix	172-174	3
β-strand	179-184	6	3
β-strand	213	1	5
β-strand	219-223	5	3
β-strand	232-234	3	6
β-strand	238-239	2	6
α-helix	240-252	13
α-helix	258-272	15
α-helix	280-282	3
β-strand	290-293	4	3
β-strand	298	1	1

Chain B: 10 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	59	1	7
β-strand	66-74	9	3
α-helix	80-82	3
α-helix	84-86	3
α-helix	90-104	15
β-strand	106-112	7	3
α-helix	116-128	13
β-strand	134-142	9	3
β-strand	145-146	2	8
β-strand	149-152	4	8
β-strand	155-158	4	8
α-helix	159-163	5
α-helix	164-166	3
α-helix	172-174	3
β-strand	179-184	6	3
β-strand	190	1	9
β-strand	192	1	10
β-strand	195	1	5
β-strand	219-223	5	3
β-strand	229	1	9
β-strand	232-234	3	11
β-strand	238-239	2	11
α-helix	240-252	13
β-strand	257	1	12
α-helix	258-272	15
α-helix	280-282	3
β-strand	286	1	10
β-strand	290-293	4	3
β-strand	298	1	7
β-strand	300	1	12

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3-4	2	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Procaspase-7	A, B	protein	250	Homo sapiens	P55210 (AlphaFold model)
Ac-devd-cmk	C, D	protein	6

Sequence of entity 1 (A, B), FASTA

>4JR2_1 Procaspase-7 (chains A, B)
SNATYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYND
CSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKT
LLEKPKLFFIQACRGTELDDGIQAASGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWR
SPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVS
MLTKELYFSQ

Sequence of entity 2 (C, D), FASTA

>4JR2_2 Ac-DEVD-CMK (chains C, D)
XDEVDX

Primary citation

Structural snapshots reveal distinct mechanisms of procaspase-3 and -7 activation. Thomsen, N.D., Koerber, J.T., Wells, J.A. Proc Natl Acad Sci U S A (2013) 110:8477-8482. DOI 10.1073/pnas.1306759110 · PubMed

Other PDB entries of the same protein (UniProt P55210 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JB8 1.7 Å, Caspase-7 in Complex with DARPin C7_16
2QL9 2.14 Å, Crystal Structure of Caspase-7 with inhibitor AC-DQMD-CHO
4JR1 2.15 Å, Human procaspase-7 bound to Ac-DEVD-CMK
5K20 2.2 Å, Caspase-7 S239E Phosphomimetic
2QLB 2.25 Å, Crystal Structure of caspase-7 with inhibitor AC-ESMD-CHO
4LSZ 2.26 Å, Caspase-7 in Complex with DARPin D7.18
4ZVR 2.3 Å, Caspase-7 Variant 4 (V4) with reprogrammed substrate specificity due to…
2QL5 2.34 Å, Crystal Structure of caspase-7 with inhibitor AC-DMQD-CHO
1F1J 2.35 Å, Crystal structure of caspase-7 in complex with acetyl-asp-glu-val-asp-cho
6CL2 2.35 Å, Caspase-7 in complex with Ac-ATS009-KE
1I4O 2.4 Å, Crystal structure of the xiap/caspase-7 complex
2QL7 2.4 Å, Crystal Structure of Caspase-7 with inhibitor AC-IEPD-CHO

Browse structure collections

About this viewer

MolViewer shows 4JR2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.