4JCJ: PDB entry 4JCJ

Crystal structure of Isl1 LIM domains with Ldb1 LIM-interaction domain. Determined by X-ray diffraction at 3.0 Å resolution. Released 19 Jun 2013.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Mus musculus
Chains: 3
Atoms: 3,095
Mol. weight: 58.85 kDa
Ligands: ZN
Released: 19 Jun 2013

Explore 4JCJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JCJ contains 15 α-helices and 59 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	16	1	1
β-strand	23	1	1
β-strand	28-32	5	2
β-strand	36-38	3	2
α-helix	40-42	3
β-strand	44	1	3
β-strand	51	1	3
α-helix	52-54	3
β-strand	57-61	5	4
β-strand	64-66	3	4
α-helix	68-74	7
β-strand	78	1	5
β-strand	85	1	5
β-strand	91-95	5	6
β-strand	98-101	4	6
α-helix	102-104	3
β-strand	106	1	7
β-strand	113	1	7
β-strand	119-122	4	8
β-strand	127-129	3	8
β-strand	302-303	2	8
β-strand	308-309	2	6
β-strand	319-321	3	4
β-strand	322-326	5	2

Chain B: 4 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	16	1	9
β-strand	23	1	9
β-strand	28-32	5	10
β-strand	36-38	3	10
α-helix	40-42	3
β-strand	44	1	11
β-strand	51	1	11
β-strand	57-61	5	12
β-strand	64-66	3	12
α-helix	68-75	8
β-strand	78	1	13
β-strand	85	1	13
β-strand	91-95	5	14
β-strand	98-101	4	14
β-strand	106	1	15
β-strand	113	1	15
β-strand	119-121	3	16
β-strand	128-129	2	16
α-helix	130-134	5
β-strand	302-303	2	16
α-helix	304-307	4
β-strand	308-309	2	14
β-strand	319-321	3	12
β-strand	324-326	3	10

Chain C: 7 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	16	1	17
β-strand	23	1	17
β-strand	28-32	5	18
β-strand	36-38	3	18
β-strand	44	1	19
β-strand	51	1	19
α-helix	52-54	3
β-strand	57-61	5	20
β-strand	64-66	3	20
α-helix	68-75	8
β-strand	91-92	2	21
β-strand	93-95	3	22
β-strand	98-100	3	22
α-helix	102-104	3
β-strand	106	1	23
α-helix	112	1
β-strand	113	1	23
α-helix	114-115	2
β-strand	119-123	5	24
β-strand	126-129	4	24
α-helix	130-133	4
β-strand	302-303	2	24
α-helix	304-307	4
β-strand	308-309	2	21
β-strand	319-321	3	20
β-strand	322-326	5	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin gene enhancer protein ISL-1,LIM domain-binding protein 1	A, B, C	protein	173	Mus musculus	P61372 (AlphaFold model), P70662 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>4JCJ_1 Insulin gene enhancer protein ISL-1,LIM domain-binding protein 1 (chains A, B, C)
GSKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDESCTCFVRDGKTYCK
RDYIRLYGIKCAKCSIGFSKNDFVMRARSKVYHIECFRCVACSRQLIPGDEFALREDGLF
CRADHDVVERGGSGGHMGSGGGDVMVVGEPTLMGGEFGDEDERLITRLENTQF

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	12

Primary citation

A structural basis for the regulation of the LIM-homeodomain protein islet 1 (Isl1) by intra- and intermolecular interactions. Gadd, M.S., Jacques, D.A., Nisevic, I. et al. J Biol Chem (2013) 288:21924-21935. DOI 10.1074/jbc.M113.478586 · PubMed

Other PDB entries of the same protein (UniProt P61372 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2RGT 2.05 Å, Crystal Structure of Lhx3 LIM domains 1 and 2 with the binding domain of Isl1

Browse structure collections

About this viewer

MolViewer shows 4JCJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.