4JHN: RPGR RCC1-like domain

The crystal structure of the RPGR RCC1-like domain. Determined by X-ray diffraction at 1.7 Å resolution. Released 17 Apr 2013.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 4
Atoms: 12,042
Mol. weight: 183.86 kDa
Released: 17 Apr 2013

Explore 4JHN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JHN contains 23 α-helices and 123 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	13-18	6	1
β-strand	28-30	3	1
β-strand	32	1	2
β-strand	35	1	2
β-strand	37-42	6	3
β-strand	46-51	6	3
β-strand	56-61	6	3
β-strand	69	1	4
β-strand	74-80	7	3
α-helix	82-84	3
β-strand	89-94	6	5
β-strand	98-103	6	5
β-strand	108-112	5	5
β-strand	127-132	6	5
β-strand	142-147	6	6
β-strand	151-156	6	6
β-strand	161-166	6	6
β-strand	179-185	7	6
β-strand	192-197	6	7
β-strand	201-206	6	7
β-strand	211-215	5	7
α-helix	226-231	6
β-strand	236-237	2	7
α-helix	244	1
β-strand	245-250	6	8
β-strand	254-259	6	8
β-strand	263-268	6	8
β-strand	282-288	7	8
β-strand	297-302	6	9
β-strand	306-311	6	9
β-strand	316-320	5	9
α-helix	323-325	3
β-strand	337-342	6	9
α-helix	344-346	3
β-strand	349-356	8	1
β-strand	360-367	8	1

Chain B: 6 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	13-18	6	10
β-strand	28-30	3	10
β-strand	32	1	11
β-strand	35	1	11
β-strand	37-42	6	12
β-strand	46-51	6	12
β-strand	56-61	6	12
β-strand	69	1	13
β-strand	74-80	7	12
α-helix	82-84	3
β-strand	89-94	6	14
β-strand	98-103	6	14
β-strand	108-112	5	14
β-strand	127-133	7	14
β-strand	142-147	6	15
β-strand	151-156	6	15
β-strand	161-166	6	15
β-strand	179-185	7	15
β-strand	192-197	6	16
β-strand	201-206	6	16
β-strand	211-215	5	16
α-helix	226-231	6
β-strand	236-237	2	16
α-helix	244	1
β-strand	245-250	6	17
β-strand	254-259	6	17
β-strand	263-268	6	17
β-strand	282-288	7	17
α-helix	290-292	3
β-strand	297-302	6	18
β-strand	306-311	6	18
β-strand	316-320	5	18
α-helix	323-325	3
β-strand	337-342	6	18
α-helix	344-346	3
β-strand	349-356	8	10
β-strand	360-367	8	10

Chain C: 6 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	13-18	6	19
β-strand	28-30	3	19
β-strand	32	1	20
β-strand	35	1	20
β-strand	37-42	6	21
β-strand	46-51	6	21
β-strand	56-61	6	21
β-strand	74-80	7	21
α-helix	82-84	3
β-strand	89-94	6	22
β-strand	98-103	6	22
β-strand	108-112	5	22
β-strand	127-132	6	22
β-strand	142-147	6	23
β-strand	151-156	6	23
β-strand	161-166	6	23
β-strand	179-185	7	23
β-strand	192-197	6	24
β-strand	201-206	6	24
β-strand	211-215	5	24
α-helix	226-231	6
β-strand	236-237	2	24
α-helix	244	1
β-strand	245-250	6	25
β-strand	254-259	6	25
β-strand	263-268	6	25
β-strand	282-288	7	25
α-helix	290-292	3
β-strand	297-302	6	26
β-strand	306-311	6	26
β-strand	316-320	5	26
α-helix	323-325	3
β-strand	337-342	6	26
α-helix	344-346	3
β-strand	349-356	8	19
β-strand	360-367	8	19

Chain D: 6 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	13-18	6	27
β-strand	28-30	3	27
β-strand	32	1	28
β-strand	35	1	28
β-strand	37-42	6	29
β-strand	46-51	6	29
β-strand	56-61	6	29
β-strand	69	1	30
β-strand	74-80	7	29
α-helix	82-84	3
β-strand	89-94	6	31
β-strand	98-103	6	31
β-strand	108-112	5	31
β-strand	127-132	6	31
β-strand	142-147	6	32
β-strand	151-156	6	32
β-strand	161-166	6	32
β-strand	179-185	7	32
β-strand	192-197	6	33
β-strand	201-206	6	33
β-strand	211-215	5	33
α-helix	226-231	6
β-strand	236-237	2	33
α-helix	244	1
β-strand	245-250	6	34
β-strand	254-259	6	34
β-strand	263-268	6	34
β-strand	282-288	7	34
α-helix	290-292	3
β-strand	297-302	6	35
β-strand	306-311	6	35
β-strand	316-320	5	35
α-helix	323-325	3
β-strand	337-342	6	35
α-helix	344-346	3
β-strand	349-356	8	27
β-strand	360-367	8	27

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
X-linked retinitis pigmentosa GTPase regulator	A, B, C, D	protein	421	Homo sapiens	Q92834 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4JHN_1 X-linked retinitis pigmentosa GTPase regulator (chains A, B, C, D)
MREPEELMPDSGAVFTFGKSKFAENNPGKFWFKNDVPVHLSCGDEHSAVVTGNNKLYMFG
SNNWGQLGLGSKSAISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLG
LGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNV
CVPQQVTIGKPVSWISCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQLVSE
IPEKVIQVACGGEHTVVLTENAVYTFGLGQFGQLGLGTFLFETSEPKVIENIRDQTISYI
SCGENHTALITDIGLMYTFGDGRHGKLGLGLENFTNHFIPTLCSNFLRFIVKLVACGGCH
MVVFAAPHRGVAKEIEFDEINDTCLSVATFLPPRRPPAYVEQKLISEEDLNSAVDHHHHH
H

Primary citation

The interplay between RPGR, PDE-delta and Arl2/3 regulate the ciliary targeting of farnesylated cargo. Watzlich, D., Vetter, I., Gotthardt, K. et al. EMBO Rep (2013) 14:465-472. DOI 10.1038/embor.2013.37 · PubMed

Other PDB entries of the same protein (UniProt Q92834 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4QAM 1.83 Å, Crystal Structure of the RPGR RCC1-like domain in complex with the RPGR-interacting…
4JHP 1.9 Å, The crystal structure of the RPGR RCC1-like domain in complex with PDE6D

Browse structure collections

About this viewer

MolViewer shows 4JHN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.