Open and closed forms of I1790Y human PRP8 RNase H-like domain with bound Mg ion. Determined by X-ray diffraction at 1.55 Å resolution. Released 22 May 2013.
Explore 4JKD in 3D Show helices and sheets RCSB PDB PDBe
4JKD contains 25 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1777-1781 | 5 | 1 |
| β-strand | 1787-1792 | 6 | 2 |
| β-strand | 1798-1803 | 6 | 2 |
| β-strand | 1805-1810 | 6 | 1 |
| β-strand | 1816-1822 | 7 | 1 |
| α-helix | 1824-1827 | 4 | |
| α-helix | 1833-1851 | 19 | |
| α-helix | 1854-1856 | 3 | |
| β-strand | 1860-1863 | 4 | 1 |
| α-helix | 1866-1868 | 3 | |
| α-helix | 1869-1875 | 7 | |
| β-strand | 1883-1886 | 4 | 1 |
| α-helix | 1893-1898 | 6 | |
| α-helix | 1900-1908 | 9 | |
| β-strand | 1913-1918 | 6 | 1 |
| α-helix | 1923-1925 | 3 | |
| α-helix | 1929-1945 | 17 | |
| α-helix | 1947-1953 | 7 | |
| α-helix | 1973-1988 | 16 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1777-1784 | 8 | 3 |
| α-helix | 1788-1792 | 5 | |
| α-helix | 1801-1803 | 3 | |
| β-strand | 1805-1810 | 6 | 3 |
| β-strand | 1816-1822 | 7 | 3 |
| α-helix | 1827-1829 | 3 | |
| α-helix | 1836-1837 | 2 | |
| α-helix | 1838-1851 | 14 | |
| α-helix | 1854-1856 | 3 | |
| β-strand | 1860-1863 | 4 | 3 |
| α-helix | 1866-1868 | 3 | |
| α-helix | 1869-1875 | 7 | |
| β-strand | 1883-1886 | 4 | 3 |
| α-helix | 1893-1898 | 6 | |
| α-helix | 1900-1908 | 9 | |
| β-strand | 1913-1918 | 6 | 3 |
| α-helix | 1923-1925 | 3 | |
| α-helix | 1929-1945 | 17 | |
| α-helix | 1947-1953 | 7 | |
| α-helix | 1973-1988 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Pre-mRNA-processing-splicing factor 8 | A, B | protein | 222 | Homo sapiens | Q6P2Q9 (AlphaFold model) |
>4JKD_1 Pre-mRNA-processing-splicing factor 8 (chains A, B) GELFSNQIIWFVDDTNVYRVTYHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWA GQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSE LQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNND RAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 2 |
Water and common crystallization additives (CL) are not listed.
A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation. Schellenberg, M.J., Wu, T., Ritchie, D.B. et al. Nat Struct Mol Biol (2013) 20:728-734. DOI 10.1038/nsmb.2556 · PubMed
Other PDB entries of the same protein (UniProt Q6P2Q9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4JKD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.