4JM0: Human Cytomegalovirus Immune Modulator UL141

Structure of Human Cytomegalovirus Immune Modulator UL141. Determined by X-ray diffraction at 3.25 Å resolution. Released 26 Feb 2014.

Method: X-ray diffraction
Resolution: 3.25 Å
Organism: Human herpesvirus 5
Chains: 2
Atoms: 2,863
Mol. weight: 60.96 kDa
Released: 26 Feb 2014

Explore 4JM0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JM0 contains 13 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	41-43	3	1
α-helix	52-54	3
β-strand	55-56	2	2
β-strand	62-70	9	3
β-strand	76-83	8	1
β-strand	91-96	6	1
β-strand	102-105	4	1
α-helix	106-108	3
β-strand	115-120	6	3
β-strand	124-132	9	3
α-helix	135-137	3
β-strand	139-146	8	1
β-strand	151-158	8	1
β-strand	159-160	2	2
β-strand	163	1	4
α-helix	181-182	2
β-strand	186	1	5
β-strand	188	1	2
α-helix	192-194	3
β-strand	195-197	3	4
β-strand	211-213	3	4
α-helix	237-240	4
β-strand	242	1	5
α-helix	243	1

Chain B: 6 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	40-43	4	6
α-helix	52-54	3
β-strand	55-56	2	7
β-strand	62-65	4	8
β-strand	69-70	2	8
β-strand	76-83	8	6
β-strand	91-96	6	6
β-strand	102-105	4	6
α-helix	106-108	3
β-strand	115-120	6	8
β-strand	124-132	9	8
α-helix	135-137	3
β-strand	139-146	8	6
β-strand	150-158	9	6
β-strand	159-160	2	7
β-strand	163	1	9
α-helix	181-182	2
β-strand	186	1	10
β-strand	188	1	7
α-helix	192-194	3
β-strand	211	1	9
α-helix	237-240	4
β-strand	242	1	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein UL141	A, B	protein	256	Human herpesvirus 5	Q6RJQ3 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4JM0_1 Protein UL141 (chains A, B)
SFPFATADIAEKMWAENYETTSPAPVLVAEGEQVTIPCTVMTHSWPMVSIRARFCRSHDG
SDELILDAVKGHRLMNGLQYRLPYATWNFSQLHLGQIFSLTFNVSTDTAGMYECVLRNYS
HGLIMQRFVILTQLETLSRPDEPCCTPALGRYSLGDQIWSPTPWRLRNHDCGMYRGFQRN
YFYIGRADAEDCWKPACPDEEPDRCWTVIQRYRLPGDCYRSQPHPPKFLPVTPAPPADID
TGMSPWATRGHHHHHH

Primary citation

The structure of cytomegalovirus immune modulator UL141 highlights structural Ig-fold versatility for receptor binding. Nemcovicova, I., Zajonc, D.M. Acta Crystallogr D Biol Crystallogr (2014) 70:851-862. DOI 10.1107/S1399004713033750 · PubMed

Other PDB entries of the same protein (UniProt Q6RJQ3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4I9X 2.1 Å, Crystal structure of human cytomegalovirus glycoprotein UL141 targeting the death…
9DIX 3.51 Å, HCMV gH/UL116/UL141 3-mer complex, ectodomain
9DIY 5.36 Å, Local Cryo-EM structure of HCMV gH/UL116 interaction

Browse structure collections

About this viewer

MolViewer shows 4JM0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.