4I9X: Protein UL141

Crystal structure of human cytomegalovirus glycoprotein UL141 targeting the death receptor TRAIL-R2. Determined by X-ray diffraction at 2.1 Å resolution. Released 3 Apr 2013.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Human herpesvirus 5, Homo sapiens
Chains: 4
Atoms: 4,933
Mol. weight: 80.13 kDa
Ligands: CA, NAG
Released: 3 Apr 2013

Explore 4I9X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4I9X contains 18 α-helices and 64 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	40-43	4	1
α-helix	47-50	4
α-helix	52-54	3
β-strand	55-56	2	1
β-strand	62-70	9	2
β-strand	76-83	8	1
β-strand	91-96	6	1
β-strand	102-105	4	1
β-strand	115-120	6	2
β-strand	124-132	9	2
β-strand	139-146	8	1
β-strand	150-160	11	1
β-strand	162-165	4	3
β-strand	186	1	4
β-strand	188	1	1
α-helix	192-194	3
β-strand	195-197	3	3
β-strand	209-213	5	3
α-helix	235-238	4
β-strand	242	1	4

Chain B: 4 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	40-43	4	5
α-helix	47-50	4
α-helix	52-54	3
β-strand	55-56	2	5
β-strand	62-70	9	6
β-strand	76-83	8	5
β-strand	91-96	6	5
β-strand	102-105	4	5
β-strand	115-120	6	6
β-strand	124-132	9	6
β-strand	139-146	8	5
β-strand	150-160	11	5
β-strand	163-165	3	7
β-strand	186	1	8
β-strand	188	1	5
α-helix	192-194	3
β-strand	196-198	3	7
β-strand	209-212	4	7
α-helix	235-238	4
β-strand	242	1	8

Chain C: 6 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	81	1	5
β-strand	85-87	3	9
β-strand	94-96	3	9
α-helix	97-98	2
β-strand	102-103	2	10
β-strand	108	1	5
α-helix	113	1
β-strand	114-115	2	10
α-helix	116-120	5
β-strand	123-127	5	11
β-strand	130	1	12
β-strand	133	1	12
β-strand	136-139	4	11
β-strand	143-145	3	13
β-strand	153-155	3	13
α-helix	156-157	2
α-helix	160-161	2
β-strand	164-166	3	14
β-strand	171	1	15
β-strand	174	1	15
α-helix	175-177	3
β-strand	178-180	3	14

Chain D: 4 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	81	1	1
β-strand	85-87	3	16
β-strand	94-96	3	16
β-strand	102-103	2	17
β-strand	108	1	1
α-helix	113	1
β-strand	114-115	2	17
α-helix	116-120	5
β-strand	123-127	5	18
β-strand	130	1	19
β-strand	133	1	19
β-strand	136-139	4	18
α-helix	140	1
β-strand	143-145	3	20
β-strand	153-155	3	20
α-helix	156-161	6
β-strand	164-168	5	21
β-strand	171	1	22
β-strand	174	1	22
β-strand	177-180	4	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein UL141	A, B	protein	215	Human herpesvirus 5	Q6RJQ3 (AlphaFold model)
Tumor necrosis factor receptor superfamily member 10B	C, D	protein	127	Homo sapiens	O14763 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4I9X_1 Protein UL141 (chains A, B)
PFATADIAEKMWAENYETTSPAPVLVAEGEQVTIPCTVMTHSWPMVSIRARFCRSHDGSD
ELILDAVKGHRLMNGLQYRLPYATWNFSQLHLGQIFSLTFNVSTDTAGMYECVLRNYSHG
LIMQRFVILTQLETLSRPDEPCCTPALGRYSLGDQIWSPTPWRLRNHDCGMYRGFQRNYF
YIGRADAEDCWKPACPDEEPDRCWTVIQRYRLPGD

Sequence of entity 2 (C, D), FASTA

>4I9X_2 Tumor necrosis factor receptor superfamily member 10B (chains C, D)
QQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCT
RCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIE
CVHKESG

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Water and common crystallization additives (NA) are not listed.

Primary citation

Structure of Human Cytomegalovirus UL141 Binding to TRAIL-R2 Reveals Novel, Non-canonical Death Receptor Interactions. Nemcovicova, I., Benedict, C.A., Zajonc, D.M. PLoS Pathog (2013) 9:e1003224-e1003224. DOI 10.1371/journal.ppat.1003224 · PubMed

Other PDB entries of the same protein (UniProt Q6RJQ3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JM0 3.25 Å, Structure of Human Cytomegalovirus Immune Modulator UL141
9DIX 3.51 Å, HCMV gH/UL116/UL141 3-mer complex, ectodomain
9DIY 5.36 Å, Local Cryo-EM structure of HCMV gH/UL116 interaction

Browse structure collections

About this viewer

MolViewer shows 4I9X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.