A unique spumavirus gag N-terminal domain with functional properties of orthoretroviral Matrix and Capsid. Determined by X-ray diffraction at 2.4 Å resolution. Released 29 May 2013.
Explore 4JNH in 3D Show helices and sheets RCSB PDB PDBe
4JNH contains 19 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-11 | 2 | 1 |
| β-strand | 12 | 1 | 2 |
| α-helix | 14-23 | 10 | |
| α-helix | 28-30 | 3 | |
| β-strand | 35-40 | 6 | 1 |
| β-strand | 43 | 1 | 3 |
| β-strand | 46 | 1 | 3 |
| β-strand | 50-59 | 10 | 1 |
| α-helix | 64 | 1 | |
| β-strand | 65-73 | 9 | 1 |
| β-strand | 85-88 | 4 | 1 |
| α-helix | 90-93 | 4 | |
| β-strand | 97 | 1 | 2 |
| α-helix | 105-112 | 8 | |
| α-helix | 122-126 | 5 | |
| α-helix | 129-131 | 3 | |
| α-helix | 132-135 | 4 | |
| α-helix | 140-177 | 38 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-11 | 3 | 4 |
| β-strand | 12 | 1 | 5 |
| α-helix | 14-23 | 10 | |
| α-helix | 28-30 | 3 | |
| β-strand | 35-40 | 6 | 4 |
| β-strand | 43 | 1 | 6 |
| β-strand | 46 | 1 | 6 |
| β-strand | 50-59 | 10 | 4 |
| α-helix | 64 | 1 | |
| β-strand | 65-73 | 9 | 4 |
| β-strand | 85-88 | 4 | 4 |
| α-helix | 90-94 | 5 | |
| β-strand | 97 | 1 | 5 |
| α-helix | 102-103 | 2 | |
| α-helix | 105-112 | 8 | |
| α-helix | 122-126 | 5 | |
| α-helix | 129-131 | 3 | |
| α-helix | 132-135 | 4 | |
| α-helix | 140-176 | 37 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Gag polyprotein | A, B | protein | 199 | Human spumaretrovirus | P14349 |
>4JNH_1 Gag polyprotein (chains A, B) MAHHHHHHSAALEVLFQGPGMASGSNVEEYELDVEALVVILRDRNIPRNPLHGEVIGLRL TEGWWGQIERFQMVRLILQNDDNEPLQRPRYEVIQRAVNPHTMFMISGPLAELQLAFQDL DLPEGPLRFGPLANGHYVQGDPYSSSYRPVTMAETAQMTRDELEDVLNTQSEIEIQMINL LELYEVETRALRRQLAERS
A Unique Spumavirus Gag N-terminal Domain with Functional Properties of Orthoretroviral Matrix and Capsid. Goldstone, D.C., Flower, T.G., Ball, N.J. et al. PLoS Pathog (2013) 9:e1003376-e1003376. DOI 10.1371/journal.ppat.1003376 · PubMed
Other PDB entries of the same protein (UniProt P14349), best resolution first:
MolViewer shows 4JNH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.