5M1H: Gag protein

Structure of a Spumaretrovirus Gag central domain reveals an ancient retroviral capsid. Determined by solution NMR. Released 26 Oct 2016.

Method: Solution NMR
Organism: Human spumaretrovirus
Chains: 1
Atoms: 1,379
Mol. weight: 19.6 kDa
Released: 26 Oct 2016

Explore 5M1H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5M1H contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	308-314	7
α-helix	324-338	15
α-helix	344-355	12
α-helix	371-382	12
α-helix	391-401	11
α-helix	404-415	12
α-helix	419-427	9
α-helix	433-445	13
α-helix	449-463	15
α-helix	464-468	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gag protein	A	protein	180	Human spumaretrovirus	P14349

Sequence of entity 1 (A), FASTA

>5M1H_1 Gag protein (chains A)
PIGTVIPIQHIRSVTGEPPRNPREIPIWLGRNAPAIDGVFPVTTPDLRCRIINAILGGNI
GLSLTPGDCLTWDSAVATLFIRTHGTFPMHQLGNVIKGIVDQEGVATAYTLGMMLSGQNY
QLVSGIIRGYLPGQAVVTALQQRLDQEIDDQTRAETFIQHLNAVYEILGLNARGQSIRLE

Primary citation

Structure of a Spumaretrovirus Gag Central Domain Reveals an Ancient Retroviral Capsid. Ball, N.J., Nicastro, G., Dutta, M. et al. PLoS Pathog (2016) 12:e1005981-e1005981. DOI 10.1371/journal.ppat.1005981 · PubMed

Other PDB entries of the same protein (UniProt P14349), best resolution first:

8Q3E 2.17 Å, High Resolution Structure of Nucleosome Core with Bound Foamy Virus GAG Peptide
4JNH 2.4 Å, A unique spumavirus gag N-terminal domain with functional properties of orthoretroviral…
8Q36 2.6 Å, Structure of Nucleosome Core with a Bound Metallopeptide Conjugate (Foamy Virus GAG…
5MLU 2.8 Å, Crystal structure of the PFV GAG CBS bound to a mononucleosome
4JMR 2.9 Å, A unique spumavirus gag N-terminal domain with functional properties of orthoretroviral…
5M1G Structure of a Spumaretrovirus Gag central domain reveals an ancient retroviral capsid

Browse structure collections

About this viewer

MolViewer shows 5M1H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.