4JXT: CID of human RPRD1A

CID of human RPRD1A in complex with a phosphorylated peptide from RPB1-CTD. Determined by X-ray diffraction at 1.9 Å resolution. Released 13 Nov 2013.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,279
Mol. weight: 18.51 kDa
Released: 13 Nov 2013

Explore 4JXT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JXT contains 8 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	6-15	10
β-strand	19	1	1
α-helix	20-32	13
α-helix	34-36	3
α-helix	37-50	14
α-helix	53-70	18
α-helix	76-95	20
α-helix	98-113	16
α-helix	119-130	12

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1621	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Regulation of nuclear pre-mRNA domain-containing protein 1A	A	protein	138	Homo sapiens	Q96P16 (AlphaFold model)
DNA-directed RNA polymerase II subunit RPB1	B	protein	21	Homo sapiens	P24928 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4JXT_1 Regulation of nuclear pre-mRNA domain-containing protein 1A (chains A)
GMSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKAKPNRKLTF
LYLANDVIQNSKRKGPEFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYEN
DVLEQLKQALYGDKKPRK

Sequence of entity 2 (B), FASTA

>4JXT_2 DNA-directed RNA polymerase II subunit RPB1 (chains B)
XSPSYSPTSPSYSPTSPSYSX

Primary citation

RPRD1A and RPRD1B are human RNA polymerase II C-terminal domain scaffolds for Ser5 dephosphorylation. Ni, Z., Xu, C., Guo, X. et al. Nat Struct Mol Biol (2014) 21:686-695. DOI 10.1038/nsmb.2853 · PubMed

Other PDB entries of the same protein (UniProt Q96P16 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4NAC 2.0 Å, Crystal Structure of the N-terminal Domain of p15RS

Browse structure collections

About this viewer

MolViewer shows 4JXT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.