Poliovirus polymerase elongation complex (r3_form). Determined by X-ray diffraction at 2.4 Å resolution. Released 22 May 2013.
Explore 4K4S in 3D Show helices and sheets RCSB PDB PDBe
4K4S contains 65 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-8 | 7 | 1 |
| α-helix | 9-11 | 3 | |
| α-helix | 14-16 | 3 | |
| β-strand | 26-27 | 2 | 2 |
| β-strand | 38-40 | 3 | 3 |
| α-helix | 41-42 | 2 | |
| α-helix | 54-59 | 6 | |
| α-helix | 72-86 | 15 | |
| α-helix | 94-96 | 3 | |
| α-helix | 97-102 | 6 | |
| β-strand | 104 | 1 | 4 |
| β-strand | 107 | 1 | 4 |
| α-helix | 108-110 | 3 | |
| α-helix | 120-123 | 4 | |
| α-helix | 127-129 | 3 | |
| α-helix | 139-148 | 10 | |
| α-helix | 152-153 | 2 | |
| β-strand | 154-158 | 5 | 1 |
| β-strand | 162-164 | 3 | 3 |
| α-helix | 165-170 | 6 | |
| β-strand | 175-178 | 4 | 1 |
| α-helix | 179-180 | 2 | |
| α-helix | 181-200 | 20 | |
| β-strand | 203 | 1 | 5 |
| β-strand | 208 | 1 | 5 |
| α-helix | 214-217 | 4 | |
| α-helix | 221-224 | 4 | |
| β-strand | 228-230 | 3 | 5 |
| β-strand | 233-234 | 2 | 6 |
| α-helix | 237-240 | 4 | |
| α-helix | 243-256 | 14 | |
| α-helix | 259-261 | 3 | |
| α-helix | 263-269 | 7 | |
| β-strand | 270-275 | 6 | 1 |
| β-strand | 278-283 | 6 | 1 |
| α-helix | 293-312 | 20 | |
| α-helix | 318-320 | 3 | |
| β-strand | 322-326 | 5 | 5 |
| β-strand | 329-334 | 6 | 5 |
| α-helix | 340-349 | 10 | |
| β-strand | 354-355 | 2 | 6 |
| α-helix | 357-359 | 3 | |
| β-strand | 373 | 1 | 7 |
| β-strand | 376 | 1 | 7 |
| β-strand | 377-380 | 4 | 8 |
| β-strand | 388-391 | 4 | 8 |
| α-helix | 394-401 | 8 | |
| β-strand | 403-404 | 2 | 2 |
| α-helix | 407-409 | 3 | |
| α-helix | 410-421 | 12 | |
| α-helix | 422-424 | 3 | |
| α-helix | 426-436 | 11 | |
| α-helix | 440-444 | 5 | |
| α-helix | 450-459 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-8 | 7 | 9 |
| α-helix | 9-11 | 3 | |
| α-helix | 14-16 | 3 | |
| α-helix | 18-20 | 3 | |
| β-strand | 26-27 | 2 | 10 |
| β-strand | 38-40 | 3 | 11 |
| α-helix | 41-42 | 2 | |
| α-helix | 54-59 | 6 | |
| α-helix | 72-86 | 15 | |
| α-helix | 94-96 | 3 | |
| α-helix | 97-102 | 6 | |
| β-strand | 104 | 1 | 12 |
| β-strand | 107 | 1 | 12 |
| α-helix | 108-110 | 3 | |
| α-helix | 120-123 | 4 | |
| α-helix | 127-129 | 3 | |
| α-helix | 139-148 | 10 | |
| α-helix | 152-153 | 2 | |
| β-strand | 154-158 | 5 | 9 |
| β-strand | 162-164 | 3 | 11 |
| α-helix | 165-170 | 6 | |
| β-strand | 175-178 | 4 | 9 |
| α-helix | 179-180 | 2 | |
| α-helix | 181-200 | 20 | |
| β-strand | 203 | 1 | 13 |
| β-strand | 208 | 1 | 13 |
| α-helix | 214-217 | 4 | |
| α-helix | 221-224 | 4 | |
| β-strand | 228-230 | 3 | 13 |
| β-strand | 233-234 | 2 | 14 |
| α-helix | 237-240 | 4 | |
| α-helix | 243-255 | 13 | |
| α-helix | 259-261 | 3 | |
| α-helix | 263-269 | 7 | |
| β-strand | 270-275 | 6 | 9 |
| β-strand | 278-283 | 6 | 9 |
| α-helix | 293-312 | 20 | |
| α-helix | 318-320 | 3 | |
| β-strand | 322-326 | 5 | 13 |
| β-strand | 329-334 | 6 | 13 |
| α-helix | 340-349 | 10 | |
| β-strand | 354-355 | 2 | 14 |
| α-helix | 357-359 | 3 | |
| β-strand | 373 | 1 | 15 |
| β-strand | 376 | 1 | 15 |
| β-strand | 377-380 | 4 | 16 |
| β-strand | 388-391 | 4 | 16 |
| α-helix | 394-401 | 8 | |
| β-strand | 403-404 | 2 | 10 |
| α-helix | 407-409 | 3 | |
| α-helix | 410-421 | 12 | |
| α-helix | 422-424 | 3 | |
| α-helix | 426-436 | 11 | |
| α-helix | 442-444 | 3 | |
| α-helix | 450-459 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| RNA-directed RNA polymerase 3D-POL | A, E | protein | 471 | Human poliovirus 1 | P03300 (AlphaFold model) |
| RNA (5'-r(*ap*ap*gp*up*cp*up*cp*cp*ap*gp*gp*up*cp*up*cp*up*cp*gp*cp*gp*ap*ap*a)-3') | B, F | RNA | 23 | ||
| RNA (5'-r(*up*gp*up*up*cp*gp*cp*gp*ap*gp*ap*gp*a)-3') | C, G | RNA | 13 | ||
| RNA (5'-r(*gp*gp*gp*ap*gp*ap*up*gp*a)-3') | D, H | RNA | 9 |
>4K4S_1 RNA-directed RNA polymerase 3D-POL (chains A, E) GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFS KYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPY VAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASS LNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDAS LSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMI NNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKS ATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLL AWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSFGSSSHHHHHH
>4K4S_2 RNA (5'-R(*AP*AP*GP*UP*CP*UP*CP*CP*AP*GP*GP*UP*CP*UP*CP*UP*CP*GP*CP*GP*AP*AP*A)-3') (chains B, F) AAGUCUCCAGGUCUCUCGCGAAA
>4K4S_3 RNA (5'-R(*UP*GP*UP*UP*CP*GP*CP*GP*AP*GP*AP*GP*A)-3') (chains C, G) UGUUCGCGAGAGA
>4K4S_4 RNA (5'-R(*GP*GP*GP*AP*GP*AP*UP*GP*A)-3') (chains D, H) GGGAGAUGA
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Water and common crystallization additives (GOL) are not listed.
Structures of coxsackievirus, rhinovirus, and poliovirus polymerase elongation complexes solved by engineering RNA mediated crystal contacts. Gong, P., Kortus, M.G., Nix, J.C. et al. PLoS One (2013) 8:e60272-e60272. DOI 10.1371/journal.pone.0060272 · PubMed
Other PDB entries of the same protein (UniProt P03300 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4K4S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.