4K51: PCI domain of eIF3a

Crystal Structure of the PCI domain of eIF3a. Determined by X-ray diffraction at 2.65 Å resolution. Released 15 Jan 2014.

Method: X-ray diffraction
Resolution: 2.65 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 3,032
Mol. weight: 51.23 kDa
Released: 15 Jan 2014

Explore 4K51 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4K51 contains 26 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	279-293	15
α-helix	296-312	17
α-helix	318-333	16
α-helix	336-337	2
α-helix	349-354	6
α-helix	363-371	9
α-helix	374-377	4
α-helix	382-388	7
α-helix	389-393	5
α-helix	400-411	12
α-helix	418-420	3
α-helix	421-439	19
β-strand	442-444	3	1
α-helix	445-452	8
α-helix	456-458	3
α-helix	462-474	13
β-strand	488-490	3	1

Chain B: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	279-293	15
α-helix	296-312	17
α-helix	318-333	16
α-helix	382-388	7
α-helix	389-393	5
α-helix	400-411	12
α-helix	418-420	3
α-helix	421-437	17
α-helix	445-452	8
α-helix	456-458	3
α-helix	462-474	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic translation initiation factor 3 subunit A	A, B	protein	224	Saccharomyces cerevisiae	P38249 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4K51_1 Eukaryotic translation initiation factor 3 subunit A (chains A, B)
GPLGSPSTLANYYENLVKVFFVSGDPLLHTTAWKKFYKLYSTNPRATEEEFKTYSSTIFL
SAISTQLDEIPSIGYDPHLRMYRLLNLDAKPTRKEMLQSIIEDESIYGKVDEELKELYDI
IEVNFDVDTVKQQLENLLVKLSSKTYFSQYIAPLRDVIMRRVFVAASQKFTTVSQSELYK
LATLPAPLDLSAWDIEKSLLQAAVEDYVSITIDHESAKVTFAKD

Primary citation

Structural integrity of the PCI domain of eIF3a/TIF32 is required for mRNA recruitment to the 43S pre-initiation complexes. Khoshnevis, S., Gunisova, S., Vlckova, V. et al. Nucleic Acids Res (2014) 42:4123-4139. DOI 10.1093/nar/gkt1369 · PubMed

Other PDB entries of the same protein (UniProt P38249 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8CAH 3.0 Å, Cryo-EM structure of native Otu2-bound ubiquitinated 43S pre-initiation complex
6FYY 3.02 Å, Structure of a partial yeast 48S preinitiation complex with eIF5 N-terminal domain…
4U1D 3.3 Å, Structure of the PCI domain of translation initiation factor eIF3a
8CAS 3.3 Å, Cryo-EM structure of native Otu2-bound ubiquitinated 48S initiation complex (partial)
4U1C 3.5 Å, Crystal structure of the eIF3a/eIF3c PCI-domain heterodimer
6FYX 3.5 Å, Structure of a partial yeast 48S preinitiation complex with eIF5 N-terminal domain…
8S8E 3.85 Å, Structure of a yeast 48S-AUC preinitiation complex in closed conformation (model…
3JAP 4.9 Å, Structure of a partial yeast 48S preinitiation complex in closed conformation
6GSM 5.15 Å, Structure of a partial yeast 48S preinitiation complex in open conformation.
6ZCE 5.3 Å, Structure of a yeast ABCE1-bound 43S pre-initiation complex
6GSN 5.75 Å, Structure of a partial yeast 48S preinitiation complex in closed conformation
6ZU9 6.2 Å, Structure of a yeast ABCE1-bound 48S initiation complex

Browse structure collections

About this viewer

MolViewer shows 4K51 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.