4U1C: EIF3a/eIF3c PCI-domain heterodimer

Name: PDB 4U1C: Crystal structure of the eIF3a/eIF3c PCI-domain heterodimer
Published: 2014-09-10
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: translation

Crystal structure of the eIF3a/eIF3c PCI-domain heterodimer. Determined by X-ray diffraction at 3.5 Å resolution. Released 10 Sept 2014.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 6,658
Mol. weight: 97.49 kDa
Released: 10 Sept 2014

Explore 4U1C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4U1C contains 49 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	226-249	24
α-helix	253-269	17
α-helix	273-275	3
α-helix	276-293	18
α-helix	296-310	15
α-helix	318-334	17
α-helix	336-337	2
α-helix	348-355	8
α-helix	363-372	10
α-helix	374-379	6
α-helix	382-392	11
α-helix	397-411	15
α-helix	415-420	6
α-helix	421-439	19
β-strand	442-444	3	1
α-helix	445-452	8
α-helix	456-458	3
α-helix	462-474	13
β-strand	480-483	4	1
β-strand	488-491	4	1

Chain C: 32 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	252-265	14
α-helix	272-285	14
α-helix	289-306	18
α-helix	315-335	21
α-helix	338-340	3
α-helix	368-386	19
α-helix	392-418	27
α-helix	422-438	17
α-helix	445-457	13
α-helix	469-472	4
α-helix	478-489	12
α-helix	496-513	18
α-helix	516-526	11
α-helix	530-534	5
α-helix	538-556	19
α-helix	560-571	12
α-helix	576-579	4
α-helix	585-592	8
α-helix	595-602	8
α-helix	608-610	3
α-helix	611-613	3
α-helix	614-637	24
α-helix	652-660	9
α-helix	666	1
α-helix	668	1
α-helix	671-684	14
α-helix	687-695	9
α-helix	698-702	5
α-helix	706-729	24
β-strand	733	1	1
β-strand	735-737	3	2
α-helix	738-745	8
α-helix	749-763	15
β-strand	768-770	3	2
β-strand	775-777	3	2
α-helix	784-793	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic translation initiation factor 3 subunit C	C	protein	567	Saccharomyces cerevisiae	P32497 (AlphaFold model)
Eukaryotic translation initiation factor 3 subunit A	A	protein	274	Saccharomyces cerevisiae	P38249 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>4U1C_1 Eukaryotic translation initiation factor 3 subunit C (chains C)
MDQAVQEDFFTRLQTIIDSRGKKTVNQQSLISTLEELLTVAEKPYEFIMAYLTLIPSRFD
ASANLSYQPIDQWKSSFNDISKLLSILDQTIDTYQVNEFADPIDFIEDEPKEDSDGVKRI
LGSIFSFVERLDDEFMKSLLNIDPHSSDYLIRLRDEQSIYNLILRTQLYFEATLKDEHDL
ERALTRPFVKRLDHIYYKSENLIKIMETAAWNIIPAQFKSKFTSKDQLDSADYVDNLIDG
LSTILSKQNNIAVQKRAILYNIYYTALNKDFQTAKDMLLTSQVQTNINQFDSSLQILFNR
VVVQLGLSAFKLCLIEECHQILNDLLSSSHLREILGQQSLHRISLNSSNNASADERARQC
LPYHQHINLDLIDVVFLTCSLLIEIPRMTAFYSGIKVKRIPYSPKSIRRSLEHYDKLSFQ
GPPETLRDYVLFAAKSMQKGNWRDSVKYLREIKSWALLPNMETVLNSLTERVQVESLKTY
FFSFKRFYSSFSVAKLAELFDLPENKVVEVLQSVIAELEIPAKLNDEKTIFVVEKGDEIT
KLEEAMVKLNKEYKIAKERLNPPSNRR

Sequence of entity 2 (A), FASTA

>4U1C_2 Eukaryotic translation initiation factor 3 subunit A (chains A)
SNAVDLSDADTLQRYLDQRFQQVDVSVKLELWHEAYRSIEDVFHLMKISKRAPKPSTLAN
YYENLVKVFFVSGDPLLHTTAWKKFYKLYSTNPRATEEEFKTYSSTIFLSAISTQLDEIP
SIGYDPHLRMYRLLNLDAKPTRKEMLQSIIEDESIYGKVDEELKELYDIIEVNFDVDTVK
QQLENLLVKLSSKTYFSQYIAPLRDVIMRRVFVAASQKFTTVSQSELYKLATLPAPLDLS
AWDIEKSLLQAAVEDYVSITIDHESAKVTFAKDP

Primary citation

Molecular Architecture of the 40SeIF1eIF3 Translation Initiation Complex. Erzberger, J.P., Stengel, F., Pellarin, R. et al. Cell (2014) 158:1123-1135. DOI 10.1016/j.cell.2014.07.044 · PubMed

Other PDB entries of the same protein (UniProt P32497 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8CAH 3.0 Å, Cryo-EM structure of native Otu2-bound ubiquitinated 43S pre-initiation complex
6FYY 3.02 Å, Structure of a partial yeast 48S preinitiation complex with eIF5 N-terminal domain…
8CAS 3.3 Å, Cryo-EM structure of native Otu2-bound ubiquitinated 48S initiation complex (partial)
6FYX 3.5 Å, Structure of a partial yeast 48S preinitiation complex with eIF5 N-terminal domain…
8S8E 3.85 Å, Structure of a yeast 48S-AUC preinitiation complex in closed conformation (model…
8S8K 4.0 Å, Structure of a yeast 48S-AUC preinitiation complex in swivelled conformation (model…
3JAP 4.9 Å, Structure of a partial yeast 48S preinitiation complex in closed conformation
6GSM 5.15 Å, Structure of a partial yeast 48S preinitiation complex in open conformation.
6ZCE 5.3 Å, Structure of a yeast ABCE1-bound 43S pre-initiation complex
6GSN 5.75 Å, Structure of a partial yeast 48S preinitiation complex in closed conformation
6ZU9 6.2 Å, Structure of a yeast ABCE1-bound 48S initiation complex
5H7U NMR structure of eIF3 36-163

Browse structure collections

About this viewer

MolViewer shows 4U1C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.