4K8V: Cyclic GMP-AMP Synthase

Structure of cyclic GMP-AMP Synthase (cGAS). Determined by X-ray diffraction at 2.0 Å resolution. Released 15 May 2013.

Method

X-ray diffraction

Resolution

2.0 Å

Organism

Mus musculus

Chains

4

Atoms

13,318

Mol. weight

170.31 kDa

Ligands

ZN

Released

15 May 2013

Explore 4K8V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4K8V contains 69 α-helices and 57 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 13 β-strands

Molecules and chains

>4K8V_1 Cyclic GMP-AMP synthase (chains A, B, C, D)
SPDKLKKVLDKLRLKRKDISEAAETVNKVVERLLRRMQKRESEFKGVEQLNTGSYYEHVK
ISAPNEFDVMFKLEVPRIELQEYYETGAFYLVKFKRIPRGNPLSHFLEGEVLSATKMLSK
FRKIIKEEVKEIKDIDVSVEKEKPGSPAVTLLIRNPEEISVDIILALESKGSWPISTKEG
LPIQGWLGTKVRTNLRREPFYLVPKNAKDGNSFQGETWRLSFSHTEKYILNNHGIEKTCC
ESSGAKCCRKECLKLMKYLLEQLKKEFQELDAFCSYHVKTAIFHMWTQDPQDSQWDPRNL
SSCFDKLLAFFLECLRTEKLDHYFIPKFNLFSQELIDRKSKEFLSKKIEYERNNGFPIFD
KL

Ligands and cofactors

Primary citation

Cyclic [G(2',5')pA(3',5')p] is the metazoan second messenger produced by DNA-activated cyclic GMP-AMP synthase. Gao, P., Ascano, M., Wu, Y. et al. Cell (2013) 153:1094-1107. DOI 10.1016/j.cell.2013.04.046 · PubMed

Related structures

Other PDB entries of the same protein (UniProt Q8C6L5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 8SHK 1.71 Å, Structure of binary complex of mouse cGAS and bound ATP
• 8SHU 1.71 Å, Structure of mouse cGAS
• 8SHY 1.77 Å, Structure of binary complex of mouse cGAS QN and bound ATP
• 5XZG 1.83 Å, Mouse cGAS bound to the inhibitor RU521
• 4O6A 1.86 Å, Mouse cyclic GMP-AMP synthase (cGAS) in complex with DNA
• 4K98 1.94 Å, Structure of Ternary Complex of cGAS with dsDNA and Bound 5 -pppG(2 ,5 )pG
• 4K99 1.95 Å, Structure of Ternary Complex of cGAS with dsDNA and Bound 5 -pppdG(2 ,5 )pdG
• 7UTT 2.04 Å, Structure of Non-hydrolyzable ATP (ApCpp) binds to Cyclic GMP AMP synthase (cGAS)…
• 4K96 2.08 Å, Structure of Binary Complex of cGAS with Bound dsDNA
• 5XZB 2.13 Å, Mouse cGAS bound to the inhibitor RU365
• 7BUJ 2.13 Å, mcGAS bound with pppGpG
• 5XZE 2.18 Å, Mouse cGAS bound to the inhibitor RU332

Browse structure collections

About this viewer

MolViewer shows 4K8V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.