Structure of Ternary Complex of cGAS with dsDNA and Bound c[G(2 ,5 )pA(3 ,5 )p]. Determined by X-ray diffraction at 2.26 Å resolution. Released 15 May 2013.
Explore 4K9B in 3D Show helices and sheets RCSB PDB PDBe
4K9B contains 19 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 150-157 | 8 | |
| α-helix | 159-160 | 2 | |
| α-helix | 161-182 | 22 | |
| β-strand | 193-197 | 5 | 1 |
| α-helix | 200-202 | 3 | |
| β-strand | 211-219 | 9 | 1 |
| β-strand | 223-227 | 5 | 1 |
| β-strand | 234-239 | 6 | 1 |
| β-strand | 252-253 | 2 | 1 |
| β-strand | 256-257 | 2 | 1 |
| α-helix | 259-275 | 17 | |
| β-strand | 281-284 | 4 | 1 |
| α-helix | 285-287 | 3 | |
| β-strand | 293-299 | 7 | 1 |
| β-strand | 303-314 | 12 | 1 |
| α-helix | 317-319 | 3 | |
| α-helix | 320-322 | 3 | |
| α-helix | 334-341 | 8 | |
| β-strand | 345-348 | 4 | 1 |
| α-helix | 350-351 | 2 | |
| β-strand | 352-354 | 3 | 2 |
| β-strand | 357-359 | 3 | 2 |
| β-strand | 363-366 | 4 | 1 |
| α-helix | 368-376 | 9 | |
| α-helix | 394-411 | 18 | |
| α-helix | 413-415 | 3 | |
| α-helix | 420-433 | 14 | |
| α-helix | 437-440 | 4 | |
| α-helix | 442-444 | 3 | |
| α-helix | 445-461 | 17 | |
| β-strand | 466 | 1 | 3 |
| β-strand | 474 | 1 | 3 |
| α-helix | 483-498 | 16 | |
| α-helix | 502-505 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cyclic GMP-AMP synthase | A | protein | 362 | Mus musculus | Q8C6L5 (AlphaFold model) |
| DNA-F | D | DNA | 17 | ||
| DNA-R | E | DNA | 17 |
>4K9B_1 Cyclic GMP-AMP synthase (chains A) SPDKLKKVLDKLRLKRKDISEAAETVNKVVERLLRRMQKRESEFKGVEQLNTGSYYEHVK ISAPNEFDVMFKLEVPRIELQEYYETGAFYLVKFKRIPRGNPLSHFLEGEVLSATKMLSK FRKIIKEEVKEIKDIDVSVEKEKPGSPAVTLLIRNPEEISVDIILALESKGSWPISTKEG LPIQGWLGTKVRTNLRREPFYLVPKNAKDGNSFQGETWRLSFSHTEKYILNNHGIEKTCC ESSGAKCCRKECLKLMKYLLEQLKKEFQELDAFCSYHVKTAIFHMWTQDPQDSQWDPRNL SSCFDKLLAFFLECLRTEKLDHYFIPKFNLFSQELIDRKSKEFLSKKIEYERNNGFPIFD KL
>4K9B_2 DNA-F (chains D) AAATTGCCGAAGACGAA
>4K9B_3 DNA-R (chains E) TTTCGTCTTCGGCAATT
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
| AMP | Adenosine monophosphate | C10 H14 N5 O7 P | 1 |
| 5GP | Guanosine-5'-monophosphate | C10 H14 N5 O8 P | 1 |
| PO4 | Phosphate ion | O4 P | 1 |
Cyclic [G(2',5')pA(3',5')p] is the metazoan second messenger produced by DNA-activated cyclic GMP-AMP synthase. Gao, P., Ascano, M., Wu, Y. et al. Cell (2013) 153:1094-1107. DOI 10.1016/j.cell.2013.04.046 · PubMed
Other PDB entries of the same protein (UniProt Q8C6L5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4K9B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.