Crystal structure of p97/VCP N in complex with OTU1 UBXL. Determined by X-ray diffraction at 1.81 Å resolution. Released 19 Mar 2014.
Explore 4KDL in 3D Show helices and sheets RCSB PDB PDBe
4KDL contains 15 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 25-29 | 5 | 1 |
| β-strand | 38-41 | 4 | 1 |
| α-helix | 43-48 | 6 | |
| α-helix | 51-52 | 2 | |
| β-strand | 53 | 1 | 2 |
| β-strand | 56-60 | 5 | 1 |
| β-strand | 66-73 | 8 | 1 |
| β-strand | 81-83 | 3 | 1 |
| α-helix | 86-91 | 6 | |
| β-strand | 99-104 | 6 | 1 |
| α-helix | 108-109 | 2 | |
| β-strand | 110 | 1 | 3 |
| α-helix | 111 | 1 | |
| β-strand | 113-118 | 6 | 4 |
| β-strand | 119 | 1 | 5 |
| α-helix | 120-123 | 4 | |
| α-helix | 130 | 1 | |
| α-helix | 131-135 | 5 | |
| α-helix | 136-139 | 4 | |
| β-strand | 144-147 | 4 | 3 |
| β-strand | 151-154 | 4 | 4 |
| β-strand | 161-169 | 9 | 4 |
| β-strand | 173-176 | 4 | 3 |
| β-strand | 181-183 | 3 | 4 |
| α-helix | 187-188 | 2 | |
| β-strand | 189 | 1 | 5 |
| α-helix | 190 | 1 | |
| α-helix | 191-193 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1-7 | 7 | 2 |
| β-strand | 10-16 | 7 | 2 |
| β-strand | 21 | 1 | 6 |
| α-helix | 22-28 | 7 | |
| β-strand | 35-38 | 4 | 2 |
| β-strand | 43-46 | 4 | 2 |
| α-helix | 54-56 | 3 | |
| β-strand | 58 | 1 | 6 |
| α-helix | 60-62 | 3 | |
| β-strand | 68-72 | 5 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transitional endoplasmic reticulum ATPase | A | protein | 193 | Homo sapiens | P55072 (AlphaFold model) |
| Ubiquitin thioesterase OTU1 | B | protein | 90 | Saccharomyces cerevisiae | P43558 (AlphaFold model) |
>4KDL_1 Transitional endoplasmic reticulum ATPase (chains A) GSHMASMTGGQQMGRGSNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKK RREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTV EGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIH CEGEPIKREDEEE
>4KDL_2 Ubiquitin thioesterase OTU1 (chains B) GSHMASMTGGQQMGRGSMKLKVTGAGINQVVTLKQDATLNDLIEHINVDVKTMRFGYPPQ RINLQGEDASLGQTQLDELGINSGEKITIE
Structural Basis for Ovarian Tumor Domain-containing Protein 1 (OTU1) Binding to p97/Valosin-containing Protein (VCP). Kim, S.J., Cho, J., Song, E.J. et al. J Biol Chem (2014) 289:12264-12274. DOI 10.1074/jbc.M113.523936 · PubMed
Other PDB entries of the same protein (UniProt P55072 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4KDL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.