4KEH: PDB entry 4KEH

Crosslinked Crystal Structure of Type II Fatty Synthase Dehydratase, FabA, and Acyl Carrier Protein, AcpP. Determined by X-ray diffraction at 1.9 Å resolution. Released 25 Dec 2013.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Escherichia coli
Chains: 4
Atoms: 4,142
Mol. weight: 55.81 kDa
Ligands: 1R3
Released: 25 Dec 2013

Explore 4KEH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4KEH contains 17 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	7	1	1
α-helix	9-16	8
α-helix	28-30	3
β-strand	38-43	6	1
β-strand	53-59	7	1
α-helix	65-69	5
α-helix	79-96	18
β-strand	102-108	7	1
β-strand	111-113	3	1
β-strand	123-135	13	1
β-strand	139-149	11	1
β-strand	152-165	14	1

Chain B: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	7	1	1
α-helix	9-16	8
α-helix	28-30	3
β-strand	38-43	6	1
β-strand	53-59	7	1
α-helix	65-69	5
α-helix	79-96	18
β-strand	102-108	7	1
β-strand	110-113	4	1
β-strand	123-135	13	1
β-strand	139-149	11	1
β-strand	152-165	14	1

Chain C: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	3-15	13
α-helix	19-21	3
β-strand	27	1	2
α-helix	36-49	14
α-helix	56-59	4
β-strand	64	1	2
α-helix	65-74	10

Chain D: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	2-14	13
α-helix	19-21	3
β-strand	27	1	3
α-helix	36-50	15
β-strand	64	1	3
α-helix	65-76	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
N-{3-[dihydroxy(nonyl)-LAMBDA~4~-sulfanyl]propyl}-N~3~-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy…	A, B	protein	171	Escherichia coli	P0A6Q3 (AlphaFold model)
Acyl carrier protein	C, D	protein	77	Escherichia coli	P0A6A8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4KEH_1 N-{3-[DIHYDROXY(NONYL)-LAMBDA~4~-SULFANYL]PROPYL}-N~3~-[(2R)-2-HYDROXY-3,3-DIMETHYL-4-(PHOSPHONOOXY)BUTANOYL]-BETA-ALANINAMIDE (chains A, B)
VDKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELDI
NPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPT
AKKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTASDLKVGLFQDTSAF

Sequence of entity 2 (C, D), FASTA

>4KEH_2 Acyl carrier protein (chains C, D)
STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAE
KITTVQAAIDYINGHQA

Ligands and cofactors

ID	Name	Formula	Copies
1R3	N-{3-[dihydroxy(nonyl)-lambda~4~-sulfanyl]propyl}-N~3~-[(2R)-2-hydroxy-3,3-dime…	C21 H45 N2 O9 P S	2

Primary citation

Trapping the dynamic acyl carrier protein in fatty acid biosynthesis. Nguyen, C., Haushalter, R.W., Lee, D.J. et al. Nature (2014) 505:427-431. DOI 10.1038/nature12810 · PubMed

Other PDB entries of the same protein (UniProt P0A6Q3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MKA 2.0 Å, E. Coli beta-hydroxydecanoyl thiol ester dehydrase modified by its classic…
1MKB 2.0 Å, Escherichia coli beta-hydroxydecanoyl thiol ester dehydrase at PH 5 and 21 degrees C

Browse structure collections

About this viewer

MolViewer shows 4KEH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.