Inhibition of Small GTPases by Stabilization of the GDP Complex, a Novel Approach applied to Rit1, a Target for Rheumatoid Arthritis. Determined by X-ray diffraction at 2.3 Å resolution. Released 17 Sept 2014.
Explore 4KLZ in 3D Show helices and sheets RCSB PDB PDBe
4KLZ contains 7 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 22-27 | 6 | 1 |
| α-helix | 34-43 | 10 | |
| β-strand | 56-64 | 9 | 1 |
| β-strand | 66-75 | 10 | 1 |
| β-strand | 95-101 | 7 | 1 |
| α-helix | 105-109 | 5 | |
| α-helix | 111-121 | 11 | |
| β-strand | 129-134 | 6 | 1 |
| α-helix | 139-141 | 3 | |
| α-helix | 146-155 | 10 | |
| β-strand | 160-162 | 3 | 1 |
| β-strand | 164 | 1 | 2 |
| α-helix | 165-167 | 3 | |
| β-strand | 169 | 1 | 2 |
| α-helix | 171-182 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| GTP-binding protein Rit1 | A | protein | 173 | Homo sapiens | Q92963 (AlphaFold model) |
>4KLZ_1 GTP-binding protein Rit1 (chains A) GSSREYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKIRIRIDDEPANLDILDT AGQAEFTAMRDQYMRAGEGFIICYSITDRRSFHEVREFKQLIYRVRRTDDTPVVLVGNKS DLKQLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVREIRRKEKEA
Inhibition of Small GTPases by Stabilization of the GDP Complex, a Novel Approach applied to Rit1, a Target for Rheumatoid Arthritis. Shah, D.M., Kobayashi, M., Keizers, P.H. et al. To be published.
Other PDB entries of the same protein (UniProt Q92963 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4KLZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.