9MF1: RIT1 in the GDP state

Crystal structure of RIT1 in the GDP state. Determined by X-ray diffraction at 2.2 Å resolution. Released 10 Sept 2025.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,667
Mol. weight: 23.3 kDa
Ligands: GDP, MG
Released: 10 Sept 2025

Explore 9MF1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9MF1 contains 6 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	21-28	8	1
α-helix	34-43	10
β-strand	56-64	9	1
β-strand	67-75	9	1
α-helix	84-92	9
β-strand	95-101	7	1
α-helix	105-122	18
β-strand	129-134	6	1
α-helix	139-141	3
α-helix	146-156	11
β-strand	160-162	3	1
β-strand	164	1	2
β-strand	169	1	2
α-helix	171-194	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GTP-binding protein Rit1	A	protein	197	Homo sapiens	Q92963 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9MF1_1 GTP-binding protein Rit1 (chains A)
GDSGTRPVGSCCSSPAGLSREYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKI
RIRIDDEPANLDILDTAGQAEFTAMRDQYMRAGEGFIICYSITDRRSFHEVREFKQLIYR
VRRTDDTPVVLVGNKSDLKQLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVR
EIRRKEKEAVLAMEKKS

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1
MG	Magnesium ion	Mg	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

Structural basis for LZTR1 recognition of RAS GTPases for degradation. Dharmaiah, S., Bonsor, D.A., Mo, S.P. et al. Science (2025) 389:1112-1117. DOI 10.1126/science.adv7088 · PubMed

Other PDB entries of the same protein (UniProt Q92963 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4KLZ 2.3 Å, Inhibition of Small GTPases by Stabilization of the GDP Complex, a Novel Approach…
9MEY 2.95 Å, Crystal structure of RIT1(GDP) bound to LZTR1(Kelch domain)

Browse structure collections

About this viewer

MolViewer shows 9MF1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.