4KR1: Kinetechore protein Iml3 from budding yeast

Crystal structure of the kinetechore protein Iml3 from budding yeast. Determined by X-ray diffraction at 2.5 Å resolution. Released 18 Dec 2013.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 1,697
Mol. weight: 28.66 kDa
Released: 18 Dec 2013

Explore 4KR1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4KR1 contains 9 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	1
β-strand	6-10	5	2
α-helix	16-27	12
β-strand	32-39	8	2
β-strand	52-59	8	2
β-strand	72-77	6	2
β-strand	85-90	6	2
α-helix	95-107	13
β-strand	111-113	3	2
α-helix	118-129	12
β-strand	130-132	3	3
β-strand	138-140	3	3
β-strand	145-149	5	1
β-strand	161-165	5	1
α-helix	167-176	10
α-helix	183	1
α-helix	184-188	5
α-helix	189-196	8
α-helix	200-202	3
β-strand	205-210	6	1
β-strand	214-217	4	1
β-strand	221-223	3	1
α-helix	230-239	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Central kinetochore subunit IML3	A	protein	247	Saccharomyces cerevisiae	P38265 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4KR1_1 Central kinetochore subunit IML3 (chains A)
GSMPYTWKFLGISKQLSLENGIAKLNQLLNLEVDLDIQTIRVPSDPDGGTAADEYIRYEM
RLDISNLDEGTYSKFIFLGNSKMEVPMFLCYCGTDNRNEVVLQWLKAEYGVIMWPIKFEQ
KTMIKLADASIVHVTKENIEQITWFSSKLYFEPETQDKNLRQFSIEIPRESCEGLALGYG
NTMHPYNDAIVPYIYNETGMAVERLPLTSVILAGHTKIMRESIVTSTRSLRNRVLAVVLQ
SIQFTSE

Primary citation

Structural insights into the role of the Chl4-Iml3 complex in kinetochore assembly. Guo, Q., Tao, Y., Liu, H. et al. Acta Crystallogr D Biol Crystallogr (2013) 69:2412-2419. DOI 10.1107/S0907444913022397 · PubMed

Other PDB entries of the same protein (UniProt P38265 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JE3 2.28 Å, An Iml3-Chl4 heterodimer links the core centromere to factors required for accurate…
4IT3 2.5 Å, Crystal Structure of Iml3 from S. cerevisiae
10FI 3.3 Å, apo CCAN purified from budding yeast
8OVW 3.4 Å, Cryo-EM structure of CBF1-CCAN bound topologically to centromeric DNA
8OW0 3.4 Å, Cryo-EM structure of CBF1-CCAN bound topologically to a centromeric CENP-A nucleosome
6QLF 3.45 Å, Structure of inner kinetochore CCAN complex with mask1
6QLE 3.55 Å, Structure of inner kinetochore CCAN complex
8OW1 3.7 Å, Cryo-EM structure of the yeast Inner kinetochore bound to a CENP-A nucleosome.
10DQ 3.9 Å, Cbf1-CCAN-CEN complex
6QLD 4.15 Å, Structure of inner kinetochore CCAN-Cenp-A complex
6NUW 4.25 Å, Yeast Ctf19 complex
10JC 6.5 Å, CCAN dimer purified from budding yeast

Browse structure collections

About this viewer

MolViewer shows 4KR1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.