Crystal structure of the DIDO PHD finger in complex with H3K4me3. Determined by X-ray diffraction at 1.35 Å resolution. Released 24 Jul 2013.
Explore 4L7X in 3D Show helices and sheets RCSB PDB PDBe
4L7X contains 2 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8 | 1 | 1 |
| β-strand | 13 | 1 | 1 |
| β-strand | 20-22 | 3 | 2 |
| β-strand | 29-31 | 3 | 2 |
| α-helix | 32-35 | 4 | |
| α-helix | 39-48 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 82-83 | 2 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Death-inducer obliterator 1 | A | protein | 63 | Homo sapiens | Q9BTC0 (AlphaFold model) |
| Histone H3 peptide | U | protein | 12 | Homo sapiens | P68431 (AlphaFold model) |
>4L7X_1 Death-inducer obliterator 1 (chains A) GPLPNALYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTIL QVQ
>4L7X_2 Histone H3 peptide (chains U) ARTKQTARKSTG
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Dido3 PHD Modulates Cell Differentiation and Division. Gatchalian, J., Futterer, A., Rothbart, S.B. et al. Cell Rep (2013) 4:148-158. DOI 10.1016/j.celrep.2013.06.014 · PubMed
Other PDB entries of the same protein (UniProt Q9BTC0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4L7X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.