4LAD: Ube2g2:RING-G2BR complex

Crystal Structure of the Ube2g2:RING-G2BR complex. Determined by X-ray diffraction at 2.3 Å resolution. Released 28 Aug 2013.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,844
Mol. weight: 34.36 kDa
Ligands: OXL, ZN
Released: 28 Aug 2013

Explore 4LAD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LAD contains 10 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	4-18	15
α-helix	20-21	2
β-strand	24-28	5	1
β-strand	36-42	7	1
α-helix	43-44	2
β-strand	53-59	7	1
α-helix	68-69	2
β-strand	70-73	4	1
β-strand	82	1	2
β-strand	87	1	1
β-strand	88	1	2
α-helix	91-93	3
α-helix	116-128	13
α-helix	138-145	8
α-helix	148-162	15

Chain B: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	351-353	3	3
β-strand	359-361	3	3
α-helix	362-369	8
α-helix	575-597	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-conjugating enzyme E2 G2	A	protein	165	Homo sapiens	P60604 (AlphaFold model)
E3 ubiquitin-protein ligase AMFR	B	protein	150	Homo sapiens	Q9UKV5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4LAD_1 Ubiquitin-conjugating enzyme E2 G2 (chains A)
MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSF
PLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKIL
LSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL

Sequence of entity 2 (B), FASTA

>4LAD_2 E3 ubiquitin-protein ligase AMFR (chains B)
HMKNYLRVVGNMEARFAVATPEELAVNNDDCAICWDSMQAARKLPCGHLFHNSCLRSWLE
QDTSCPTCRMSLNIADNNRVREEGGGGGGGSSGSSGGSGGGSGSSSGGGGGSGGGSGGGG
GGGSADERQRMLVQRKDELLQQARKRFLNK

Ligands and cofactors

ID	Name	Formula	Copies
OXL	Oxalate ion	C2 O4	2
ZN	Zinc ion	Zn	2

Primary citation

Allosteric regulation of E2:E3 interactions promote a processive ubiquitination machine. Das, R., Liang, Y.H., Mariano, J. et al. EMBO J (2013) 32:2504-2516. DOI 10.1038/emboj.2013.174 · PubMed

Other PDB entries of the same protein (UniProt P60604 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LEW 1.74 Å, Crystal structure of UBE2G2 in complex with the UBE2G2-binding region of AUP1
3H8K 1.8 Å, Crystal structure of Ube2g2 complxed with the G2BR domain of gp78 at 1.8-A resolution
8T0S 1.95 Å, Crystal structure of UBE2G2 adduct with phenethyl isothiocyanate (PEITC) at the Cys48…
2CYX 2.56 Å, Structure of human ubiquitin-conjugating enzyme E2 G2 (UBE2G2/UBC7)
2KLY Solution structure of human ubiquitin conjugating enzyme Ube2g2
2LXP NMR structure of two domains in ubiquitin ligase gp78, RING and G2BR, bound to its…

Browse structure collections

About this viewer

MolViewer shows 4LAD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.