4LEZ: Mouse cGAS

Structure of mouse cGAS bound to an 18bp DNA and cGAS product. Determined by X-ray diffraction at 2.36 Å resolution. Released 25 Dec 2013.

Method: X-ray diffraction
Resolution: 2.36 Å
Organism: Mus musculus
Chains: 6
Atoms: 7,645
Mol. weight: 109.51 kDa
Ligands: 1SY, ZN
Released: 25 Dec 2013

Explore 4LEZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LEZ contains 39 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	150-157	8
α-helix	158-160	3
α-helix	161-182	22
β-strand	193-197	5	1
α-helix	199-202	4
β-strand	211-219	9	1
β-strand	224-227	4	1
β-strand	234-238	5	1
α-helix	249-251	3
β-strand	252	1	2
β-strand	256	1	1
β-strand	257	1	2
α-helix	259-275	17
β-strand	281-284	4	1
α-helix	287-288	2
β-strand	293-300	8	1
β-strand	302-314	13	1
α-helix	317-319	3
α-helix	320-322	3
α-helix	334-341	8
β-strand	345-349	5	1
α-helix	359-361	3
β-strand	363-366	4	1
α-helix	368-376	9
β-strand	381	1	3
α-helix	394-411	18
α-helix	413-415	3
α-helix	420-433	14
α-helix	437-440	4
α-helix	442-444	3
α-helix	445-462	18
β-strand	466	1	4
β-strand	474	1	4
α-helix	483-498	16
α-helix	502-505	4

Chain C: 19 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	150-157	8
α-helix	161-184	24
β-strand	193-197	5	5
α-helix	199-202	4
β-strand	211-219	9	5
β-strand	223-227	5	5
β-strand	234-239	6	5
β-strand	252	1	6
β-strand	256	1	5
β-strand	257	1	6
α-helix	259-275	17
β-strand	281-284	4	5
α-helix	287-288	2
β-strand	293-299	7	5
β-strand	303-314	12	5
α-helix	317-319	3
α-helix	320-322	3
α-helix	334-342	9
β-strand	345-348	4	5
α-helix	350-352	3
α-helix	359-361	3
β-strand	363-366	4	5
α-helix	368-376	9
β-strand	381	1	3
α-helix	394-411	18
α-helix	413-415	3
α-helix	420-433	14
α-helix	437-440	4
α-helix	442-444	3
α-helix	445-462	18
β-strand	466	1	7
β-strand	474	1	7
α-helix	483-498	16
α-helix	502-504	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cyclic GMP-AMP synthase	A, C	protein	366	Mus musculus	Q8C6L5 (AlphaFold model)
18bp dsDNA	E, F, I, J	DNA	18

Sequence of entity 1 (A, C), FASTA

>4LEZ_1 Cyclic GMP-AMP synthase (chains A, C)
GSRKEPDKLKKVLDKLRLKRKDISEAAETVNKVVERLLRRMQKRESEFKGVEQLNTGSYY
EHVKISAPNEFDVMFKLEVPRIELQEYYETGAFYLVKFKRIPRGNPLSHFLEGEVLSATK
MLSKFRKIIKEEVKEIKDIDVSVEKEKPGSPAVTLLIRNPEEISVDIILALESKGSWPIS
TKEGLPIQGWLGTKVRTNLRREPFYLVPKNAKDGNSFQGETWRLSFSHTEKYILNNHGIE
KTCCESSGAKCCRKECLKLMKYLLEQLKKEFQELDAFCSYHVKTAIFHMWTQDPQDSQWD
PRNLSSCFDKLLAFFLECLRTEKLDHYFIPKFNLFSQELIDRKSKEFLSKKIEYERNNGF
PIFDKL

Sequence of entity 2 (E, F, I, J), FASTA

>4LEZ_2 18bp dsDNA (chains E, F, I, J)
ATCTGTACATGTACAGAT

Ligands and cofactors

ID	Name	Formula	Copies
1SY	cGAMP	C20 H24 N10 O13 P2	2
ZN	Zinc ion	Zn	2

Primary citation

Cyclic GMP-AMP Synthase Is Activated by Double-Stranded DNA-Induced Oligomerization. Li, X., Shu, C., Yi, G. et al. Immunity (2013) 39:1019-1031. DOI 10.1016/j.immuni.2013.10.019 · PubMed

Other PDB entries of the same protein (UniProt Q8C6L5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8SHK 1.71 Å, Structure of binary complex of mouse cGAS and bound ATP
8SHU 1.71 Å, Structure of mouse cGAS
8SHY 1.77 Å, Structure of binary complex of mouse cGAS QN and bound ATP
5XZG 1.83 Å, Mouse cGAS bound to the inhibitor RU521
4O6A 1.86 Å, Mouse cyclic GMP-AMP synthase (cGAS) in complex with DNA
4K98 1.94 Å, Structure of Ternary Complex of cGAS with dsDNA and Bound 5 -pppG(2 ,5 )pG
4K99 1.95 Å, Structure of Ternary Complex of cGAS with dsDNA and Bound 5 -pppdG(2 ,5 )pdG
4K8V 2.0 Å, Structure of cyclic GMP-AMP Synthase (cGAS)
7UTT 2.04 Å, Structure of Non-hydrolyzable ATP (ApCpp) binds to Cyclic GMP AMP synthase (cGAS)…
4K96 2.08 Å, Structure of Binary Complex of cGAS with Bound dsDNA
5XZB 2.13 Å, Mouse cGAS bound to the inhibitor RU365
7BUJ 2.13 Å, mcGAS bound with pppGpG

Browse structure collections

About this viewer

MolViewer shows 4LEZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.