4LG6: ANKRA2-CCDC8 complex

Crystal structure of ANKRA2-CCDC8 complex. Determined by X-ray diffraction at 1.8 Å resolution. Released 25 Sept 2013.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,389
Mol. weight: 20.86 kDa
Released: 25 Sept 2013

Explore 4LG6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LG6 contains 11 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	153-159	7
α-helix	162-171	10
α-helix	185-191	7
α-helix	195-203	9
α-helix	218-225	8
α-helix	228-236	9
α-helix	251-257	7
α-helix	261-269	9
α-helix	284-291	8
α-helix	294-309	16

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	502-506	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ankyrin repeat family A protein 2	A	protein	173	Homo sapiens	Q9H9E1 (AlphaFold model)
Coiled-coil domain-containing protein 8	B	protein	17	Homo sapiens	Q9H0W5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4LG6_1 Ankyrin repeat family A protein 2 (chains A)
GSTTPLLANSLSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEF
LLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNH
VKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVIESHLLKLLQNIKE

Sequence of entity 2 (B), FASTA

>4LG6_2 Coiled-coil domain-containing protein 8 (chains B)
RAFWHTPRLPTLPKRVP

Primary citation

Ankyrin Repeats of ANKRA2 Recognize a PxLPxL Motif on the 3M Syndrome Protein CCDC8. Nie, J., Xu, C., Jin, J. et al. Structure (2015) 23:700-712. DOI 10.1016/j.str.2015.02.001 · PubMed

Other PDB entries of the same protein (UniProt Q9H9E1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3V31 1.57 Å, Crystal Structure of the Peptide Bound Complex of the Ankyrin Repeat Domains of Human…
3V2X 1.85 Å, Crystal Structure of the Peptide Bound Complex of the Ankyrin Repeat Domains of Human…
3V2O 1.89 Å, Crystal Structure of the Peptide Bound Complex of the Ankyrin Repeat Domains of Human…
3SO8 1.9 Å, Crystal Structure of ANKRA
4QQI 2.03 Å, Crystal structure of ANKRA2-RFX7 complex
8CXG 3.2 Å, Structures of Zika Virus in Complex with Antibodies Targeting E Dimer Epitopes and Basis…
8CXH 3.2 Å, Structures of Zika Virus in Complex with Antibodies Targeting E Dimer Epitopes and Basis…
8CXI 3.4 Å, Structures of Zika Virus in Complex with Antibodies Targeting E Dimer Epitopes and Basis…

Browse structure collections

About this viewer

MolViewer shows 4LG6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.