Crystal Structure of MOZ double PHD finger histone H3K9ac complex. Determined by X-ray diffraction at 1.61 Å resolution. Released 16 Oct 2013.
Explore 4LKA in 3D Show helices and sheets RCSB PDB PDBe
4LKA contains 9 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 203-206 | 4 | |
| β-strand | 209 | 1 | 1 |
| α-helix | 226-227 | 2 | |
| β-strand | 228-229 | 2 | 1 |
| β-strand | 236-237 | 2 | 1 |
| α-helix | 239-242 | 4 | |
| α-helix | 246-253 | 8 | |
| β-strand | 265 | 1 | 2 |
| α-helix | 275-277 | 3 | |
| β-strand | 278-280 | 3 | 2 |
| β-strand | 287-289 | 3 | 2 |
| α-helix | 290-292 | 3 | |
| α-helix | 296-297 | 2 | |
| α-helix | 312-314 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 2 |
| α-helix | 4-11 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histone acetyltransferase KAT6A | A | protein | 136 | Homo sapiens | Q92794 (AlphaFold model) |
| Histone H3.1 | B | protein | 21 | Homo Sapiens | P68431 (AlphaFold model) |
>4LKA_1 Histone acetyltransferase KAT6A (chains A) GSHMLELPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPE LTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWIC QICRPRKKGRKLLQKK
>4LKA_2 Histone H3.1 (chains B) ARTKQTARKSTGGKAPRKQLA
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 4 |
The double PHD finger domain of MOZ/MYST3 induces alpha-helical structure of the histone H3 tail to facilitate acetylation and methylation sampling and modification. Dreveny, I., Deeves, S.E., Fulton, J. et al. Nucleic Acids Res (2014) 42:822-835. DOI 10.1093/nar/gkt931 · PubMed
Other PDB entries of the same protein (UniProt Q92794 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4LKA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.