7Y43: Histone acetyltransferase KAT6A

Crystal structure of the KAT6A WH domain and its bound double stranded DNA. Determined by X-ray diffraction at 1.5 Å resolution. Released 18 Jan 2023.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,331
Mol. weight: 18.25 kDa
Ligands: MG
Released: 18 Jan 2023

Explore 7Y43 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7Y43 contains 3 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	7-22	16
α-helix	29-40	12
α-helix	44-57	14
β-strand	61-65	5	1
β-strand	68-72	5	1
β-strand	73	1	2
β-strand	76	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone acetyltransferase KAT6A	A	protein	86	Homo sapiens	Q92794 (AlphaFold model)
DNA (5'-d(gpgpapgptpgpcpgpcpapcptpcpc)-3')	B, C	DNA	14	Homo sapiens

Sequence of entity 1 (A), FASTA

>7Y43_1 Histone acetyltransferase KAT6A (chains A)
SMVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGT
ILKVSNKGLNSYKDPDNPGRIALPKP

Sequence of entity 2 (B, C), FASTA

>7Y43_2 DNA (5'-D(*GP*GP*AP*GP*TP*GP*CP*GP*CP*AP*CP*TP*CP*C)-3') (chains B, C)
GGAGTGCGCACTCC

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Primary citation

The histone acetyltransferase KAT6A is recruited to unmethylated CpG islands via a DNA binding winged helix domain. Weber, L.M., Jia, Y., Stielow, B. et al. Nucleic Acids Res (2023) 51:574-594. DOI 10.1093/nar/gkac1188 · PubMed

Other PDB entries of the same protein (UniProt Q92794 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5B78 1.4 Å, Crystal structure of MOZ double PHD finger mutant-S210D/N235R in complex with histone H3…
3V43 1.47 Å, Crystal structure of MOZ
5B77 1.55 Å, Crystal structrue of MOZ double PHD finger in complex with histone H3 propionylation at…
4LK9 1.6 Å, Crystal Structure of MOZ double PHD finger histone H3 tail complex
4LKA 1.61 Å, Crystal Structure of MOZ double PHD finger histone H3K9ac complex
5B76 1.65 Å, Crystal structure of MOZ double PHD finger domain in complex with histone H3…
5B75 1.7 Å, Crystal structure of MOZ double PHD finger in complex with histone H3 butyrylation at K14
9DZN 1.72 Å, KAT6A MYST domain complexed with a H3K14-CoA bisubstrate inhibitor
8H7A 1.92 Å, Crystal structure of the dimer form KAT6A WH domain with its bound double stranded DNA
6LSB 2.0 Å, Crystal Structure of DPF domain of MOZ in complex with H3K14bz peptide
9ARR 2.1 Å, Crystal structure of AF9 YEATS domain in complex with dicrotonylated at K1007 and K1014…
29UQ 2.13 Å, KAT6A surface mutant in complex with co-factor acetyl-co-a

Browse structure collections

About this viewer

MolViewer shows 7Y43 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.