4LLA: D3D4 domain of the LILRB2 molecule

Crystal structure of D3D4 domain of the LILRB2 molecule. Determined by X-ray diffraction at 2.5 Å resolution. Released 11 Sept 2013.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,609
Mol. weight: 64.57 kDa
Released: 11 Sept 2013

Explore 4LLA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LLA contains 15 α-helices and 69 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
β-strand	8-12	5	1
β-strand	16-17	2	2
β-strand	23-29	7	1
β-strand	35-40	6	3
β-strand	46-50	5	3
β-strand	52	1	1
β-strand	59-65	7	1
α-helix	70-72	3
β-strand	74-81	8	3
β-strand	88	1	3
α-helix	90-94	5
β-strand	95-97	3	3
β-strand	98-99	2	2
β-strand	108-112	5	4
β-strand	116-117	2	5
β-strand	124-129	6	4
β-strand	135-140	6	6
β-strand	148-151	4	6
α-helix	152	1
β-strand	153-155	3	4
β-strand	158-164	7	4
α-helix	170-172	3
β-strand	174-182	9	6
β-strand	185-189	5	6
β-strand	196-198	3	6
β-strand	199-200	2	5

Chain B: 5 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
β-strand	8-12	5	7
β-strand	16-17	2	8
β-strand	23-29	7	7
β-strand	35-40	6	9
β-strand	46-50	5	9
β-strand	52	1	7
β-strand	59-65	7	7
α-helix	70-72	3
β-strand	74-81	8	9
β-strand	88	1	9
α-helix	89-94	6
β-strand	95-97	3	9
β-strand	98-103	6	8
β-strand	108-112	5	10
β-strand	116-117	2	11
β-strand	124-129	6	10
β-strand	135-140	6	12
α-helix	146-147	2
β-strand	148-151	4	12
α-helix	152	1
β-strand	153-155	3	10
β-strand	158-164	7	10
β-strand	174-181	8	12
β-strand	188	1	8
β-strand	189	1	12
β-strand	190	1	8
β-strand	196-198	3	12
β-strand	199-200	2	11

Chain C: 5 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
β-strand	8-12	5	13
β-strand	16-17	2	14
β-strand	23-29	7	13
β-strand	35-40	6	15
β-strand	46-50	5	15
β-strand	52	1	13
β-strand	59-65	7	13
α-helix	70-72	3
β-strand	74-81	8	15
β-strand	88	1	15
α-helix	90-94	5
β-strand	95-97	3	15
β-strand	98-99	2	14
β-strand	108-112	5	16
β-strand	116-117	2	17
β-strand	124-129	6	16
β-strand	135-140	6	18
β-strand	148-151	4	18
α-helix	152	1
β-strand	153-155	3	16
β-strand	158-164	7	16
α-helix	170-172	3
β-strand	174-181	8	18
β-strand	188	1	14
β-strand	189	1	18
β-strand	196-198	3	18
β-strand	199-200	2	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leukocyte immunoglobulin-like receptor subfamily B member 2	A, B, C	protein	198	Homo sapiens	Q8N423 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>4LLA_1 Leukocyte immunoglobulin-like receptor subfamily B member 2 (chains A, B, C)
SKKPSLSVQPGPVMAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANF
TLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENV
TLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLN
SDPYLLSHPSEPLELVVS

Primary citation

Crystal structures of the two membrane-proximal Ig-like domains (D3D4) of LILRB1/B2: alternative models for their involvement in peptide-HLA binding. Nam, G., Shi, Y., Ryu, M. et al. Protein Cell (2013) 4:761-770. DOI 10.1007/s13238-013-3908-x · PubMed

Other PDB entries of the same protein (UniProt Q8N423 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9C9C 1.66 Å, Protein receptor
2GW5 1.8 Å, Crystal Structure of LIR-2 (ILT4) at 1.8 : differences from LIR-1 (ILT2) in regions…
6BCS 2.1 Å, LilrB2 D1D2 domains complexed with benzamidine
2DYP 2.5 Å, Crystal Structure of LILRB2(LIR2/ILT4/CD85d) complexed with HLA-G
9C9D 2.9 Å, Protein receptor
6AED 3.8 Å, Crystal Structure of the four Ig-like domain of LILRB2(LIR2/ILT4/CD85d)

Browse structure collections

About this viewer

MolViewer shows 4LLA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.