4LNZ: Human Myosin 5b globular domain

Crystal structure of human Myosin 5b globular domain. Determined by X-ray diffraction at 3.11 Å resolution. Released 25 Dec 2013.

Method: X-ray diffraction
Resolution: 3.11 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,840
Mol. weight: 45.11 kDa
Released: 25 Dec 2013

Explore 4LNZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LNZ contains 16 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	1471	1	1
α-helix	1477-1481	5
α-helix	1482-1486	5
α-helix	1500-1514	15
α-helix	1518-1537	20
α-helix	1543-1563	21
α-helix	1588-1620	33
α-helix	1654-1670	17
α-helix	1675-1696	22
α-helix	1706-1726	21
α-helix	1729-1731	3
α-helix	1735-1737	3
α-helix	1738-1746	9
α-helix	1754-1763	10
α-helix	1769-1777	9
α-helix	1794-1800	7
α-helix	1818-1820	3
β-strand	1846	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Unconventional myosin-Vb	A	protein	394	Homo sapiens	Q9ULV0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4LNZ_1 Unconventional myosin-Vb (chains A)
GPLGSQRKEKDFQGMLEYHKEDEALLIRNLVTDLKPQMLSGTVPCLPAYILYMCIRHADY
TNDDLKVHSLLTSTINGIKKVLKKHNDDFEMTSFWLSNTCRLLHCLKQYSGDEGFMTQNT
AKQNEHCLKNFDLTEYRQVLSDLSIQIYQQLIKIAEGVLQPMIVSAMLENESIQGLSGVK
PTGYRKRSSSMADGDNSYCLEAIIRQMNAFHTVMCDQGLDPEIILQVFKQLFYMINAVTL
NNLLLRKDVCSWSTGMQLRYNISQLEEWLRGRNLHQSGAVQTMEPLIQAAQLLQLKKKTQ
EDAEAICSLCTSLSTQQIVKILNLYTPLNEFEERVTVAFIRTIQAQLQERNDPQQLLLDA
KHMFPVLFPFNPSSLTMDSIHIPACLNLEFLNEV

Primary citation

Structural insights into the globular tails of the human type v myosins myo5a, myo5b, and myo5c. Velvarska, H., Niessing, D. PLoS One (2013) 8:e82065-e82065. DOI 10.1371/journal.pone.0082065 · PubMed

Other PDB entries of the same protein (UniProt Q9ULV0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4J5M 2.07 Å, Structure of the Cargo Binding Domain from Human Myosin Vb
4LX0 2.19 Å, Crystal structure of Myo5b globular tail domain in complex with active Rab11a
4LWZ 2.55 Å, Crystal structure of Myo5b globular tail domain in complex with inactive Rab11a

Browse structure collections

About this viewer

MolViewer shows 4LNZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.