Rickettsia rickettsii cell surface antigen 4 (sca4) head domain (residues 21-360). Determined by X-ray diffraction at 2.2 Å resolution. Released 28 Aug 2013.
Explore 4LQ8 in 3D Show helices and sheets RCSB PDB PDBe
4LQ8 contains 21 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 53-57 | 5 | 1 |
| α-helix | 84-89 | 6 | |
| α-helix | 90-94 | 5 | |
| α-helix | 95-110 | 16 | |
| α-helix | 115-131 | 17 | |
| α-helix | 136-140 | 5 | |
| α-helix | 142-144 | 3 | |
| α-helix | 145-152 | 8 | |
| α-helix | 155-175 | 21 | |
| β-strand | 177 | 1 | 2 |
| β-strand | 186 | 1 | 2 |
| β-strand | 187-188 | 2 | 1 |
| β-strand | 192-193 | 2 | 3 |
| β-strand | 200-206 | 7 | 3 |
| β-strand | 212-221 | 10 | 3 |
| β-strand | 226-229 | 4 | 4 |
| β-strand | 235-238 | 4 | 4 |
| β-strand | 240 | 1 | 5 |
| β-strand | 241-244 | 4 | 3 |
| β-strand | 249 | 1 | 1 |
| β-strand | 256-262 | 7 | 1 |
| β-strand | 264-265 | 2 | 6 |
| β-strand | 267 | 1 | 5 |
| β-strand | 278-285 | 8 | 1 |
| β-strand | 291-297 | 7 | 1 |
| β-strand | 302-305 | 4 | 6 |
| α-helix | 311 | 1 | |
| β-strand | 312-317 | 6 | 6 |
| β-strand | 320-327 | 8 | 6 |
| α-helix | 328-340 | 13 | |
| β-strand | 349-352 | 4 | 6 |
| β-strand | 355-356 | 2 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 53-57 | 5 | 7 |
| α-helix | 66-71 | 6 | |
| α-helix | 84-89 | 6 | |
| α-helix | 90-94 | 5 | |
| α-helix | 95-110 | 16 | |
| α-helix | 115-131 | 17 | |
| α-helix | 136-140 | 5 | |
| α-helix | 142-144 | 3 | |
| α-helix | 145-152 | 8 | |
| α-helix | 155-176 | 22 | |
| β-strand | 177 | 1 | 8 |
| β-strand | 186 | 1 | 8 |
| β-strand | 187-188 | 2 | 7 |
| β-strand | 192-193 | 2 | 9 |
| β-strand | 199-206 | 8 | 9 |
| β-strand | 212-221 | 10 | 9 |
| β-strand | 226-229 | 4 | 10 |
| β-strand | 235-238 | 4 | 10 |
| β-strand | 241-244 | 4 | 9 |
| β-strand | 249 | 1 | 7 |
| β-strand | 256-262 | 7 | 7 |
| β-strand | 264-265 | 2 | 11 |
| β-strand | 278-285 | 8 | 7 |
| β-strand | 291-297 | 7 | 7 |
| β-strand | 302-305 | 4 | 11 |
| α-helix | 311 | 1 | |
| β-strand | 312-317 | 6 | 11 |
| β-strand | 320-327 | 8 | 11 |
| α-helix | 328-340 | 13 | |
| β-strand | 349-352 | 4 | 11 |
| β-strand | 355-356 | 2 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sca-family protein | A, B | protein | 340 | Rickettsia rickettsii | B0BXR4 (AlphaFold model) |
>4LQ8_1 Sca-family protein (chains A, B) NKEYTEEQKQTLEQEQKEFLSQTTTPELEADDGFIVTSESSAQSTPSMSALSGNISPDSQ TSDPITKAVRETIIQPQKDNLIEQILKDLAALTDRDLAEQKRKEIEEEKEKDKTLSTFFG NPANREFIDKALEKPELKKKLESIEIAGYKNVHNTFSAASGYPGGFKPVQWENHVSASDL RATVVKNDAGDELCTLNETTVKTKPFTLAKQDGTQVQISSYREIDFPIKLDQADGSMHLS MVALKADGTKPSKDKAVYFTAHYEEGPNGKPQLKEISSPKPLKFAGTGDDAIAYIEHGGE IYTLAVTRGKYKEMMKEVELNQGQSVDLSQAEDIIIGQGQ
Crystal structure of the N-terminal domains of the surface cell antigen 4 of Rickettsia. Lee, J.H., Vonrhein, C., Bricogne, G. et al. Protein Sci (2013) 22:1425-1431. DOI 10.1002/pro.2322 · PubMed
Other PDB entries of the same protein (UniProt B0BXR4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4LQ8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.