4LQ8: Sca-family protein

Rickettsia rickettsii cell surface antigen 4 (sca4) head domain (residues 21-360). Determined by X-ray diffraction at 2.2 Å resolution. Released 28 Aug 2013.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Rickettsia rickettsii
Chains: 2
Atoms: 4,899
Mol. weight: 75.35 kDa
Released: 28 Aug 2013

Explore 4LQ8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LQ8 contains 21 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	53-57	5	1
α-helix	84-89	6
α-helix	90-94	5
α-helix	95-110	16
α-helix	115-131	17
α-helix	136-140	5
α-helix	142-144	3
α-helix	145-152	8
α-helix	155-175	21
β-strand	177	1	2
β-strand	186	1	2
β-strand	187-188	2	1
β-strand	192-193	2	3
β-strand	200-206	7	3
β-strand	212-221	10	3
β-strand	226-229	4	4
β-strand	235-238	4	4
β-strand	240	1	5
β-strand	241-244	4	3
β-strand	249	1	1
β-strand	256-262	7	1
β-strand	264-265	2	6
β-strand	267	1	5
β-strand	278-285	8	1
β-strand	291-297	7	1
β-strand	302-305	4	6
α-helix	311	1
β-strand	312-317	6	6
β-strand	320-327	8	6
α-helix	328-340	13
β-strand	349-352	4	6
β-strand	355-356	2	4

Chain B: 11 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	53-57	5	7
α-helix	66-71	6
α-helix	84-89	6
α-helix	90-94	5
α-helix	95-110	16
α-helix	115-131	17
α-helix	136-140	5
α-helix	142-144	3
α-helix	145-152	8
α-helix	155-176	22
β-strand	177	1	8
β-strand	186	1	8
β-strand	187-188	2	7
β-strand	192-193	2	9
β-strand	199-206	8	9
β-strand	212-221	10	9
β-strand	226-229	4	10
β-strand	235-238	4	10
β-strand	241-244	4	9
β-strand	249	1	7
β-strand	256-262	7	7
β-strand	264-265	2	11
β-strand	278-285	8	7
β-strand	291-297	7	7
β-strand	302-305	4	11
α-helix	311	1
β-strand	312-317	6	11
β-strand	320-327	8	11
α-helix	328-340	13
β-strand	349-352	4	11
β-strand	355-356	2	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sca-family protein	A, B	protein	340	Rickettsia rickettsii	B0BXR4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4LQ8_1 Sca-family protein (chains A, B)
NKEYTEEQKQTLEQEQKEFLSQTTTPELEADDGFIVTSESSAQSTPSMSALSGNISPDSQ
TSDPITKAVRETIIQPQKDNLIEQILKDLAALTDRDLAEQKRKEIEEEKEKDKTLSTFFG
NPANREFIDKALEKPELKKKLESIEIAGYKNVHNTFSAASGYPGGFKPVQWENHVSASDL
RATVVKNDAGDELCTLNETTVKTKPFTLAKQDGTQVQISSYREIDFPIKLDQADGSMHLS
MVALKADGTKPSKDKAVYFTAHYEEGPNGKPQLKEISSPKPLKFAGTGDDAIAYIEHGGE
IYTLAVTRGKYKEMMKEVELNQGQSVDLSQAEDIIIGQGQ

Primary citation

Crystal structure of the N-terminal domains of the surface cell antigen 4 of Rickettsia. Lee, J.H., Vonrhein, C., Bricogne, G. et al. Protein Sci (2013) 22:1425-1431. DOI 10.1002/pro.2322 · PubMed

Other PDB entries of the same protein (UniProt B0BXR4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3TJ5 1.99 Å, human vinculin head domain (Vh1, residues 1-258) in complex with the vinculin binding…
3TJ6 2.76 Å, human vinculin head domain (Vh1, residues 1-258) in complex with the vinculin binding…

Browse structure collections

About this viewer

MolViewer shows 4LQ8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.