3TJ5: Human vinculin head domain

human vinculin head domain (Vh1, residues 1-258) in complex with the vinculin binding site of the surface cell antigen 4 (sca4-VBS-N; residues 412-434) from Rickettsia rickettsii. Determined by X-ray diffraction at 1.99 Å resolution. Released 7 Sept 2011.

Method: X-ray diffraction
Resolution: 1.99 Å
Organisms: Homo sapiens, Rickettsia rickettsii str. Iowa
Chains: 2
Atoms: 2,541
Mol. weight: 31.47 kDa
Released: 7 Sept 2011

Explore 3TJ5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3TJ5 contains 10 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	1
α-helix	7-26	20
α-helix	36-39	4
α-helix	41-64	24
α-helix	68-97	30
α-helix	102-145	44
α-helix	148-150	3
α-helix	154-181	28
β-strand	182	1	1
α-helix	185-215	31
α-helix	223-248	26

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	413-433	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vinculin	A	protein	255	Homo sapiens	P18206 (AlphaFold model)
Antigenic heat-stable 120 kDa protein	B	protein	27	Rickettsia rickettsii str. Iowa	B0BXR4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3TJ5_1 Vinculin (chains A)
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKE
TVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTS
DLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQ
ELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAE
INEIIRVLQLTSWDE

Sequence of entity 2 (B), FASTA

>3TJ5_2 Antigenic heat-stable 120 kDa protein (chains B)
GSHMNLLNAATALSGSMQYLLNYVNAG

Primary citation

The rickettsia surface cell antigen 4 applies mimicry to bind to and activate vinculin. Park, H., Lee, J.H., Gouin, E. et al. J Biol Chem (2011) 286:35096-35103. DOI 10.1074/jbc.M111.263855 · PubMed

Other PDB entries of the same protein (UniProt P18206 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LN2 1.0 Å, The second SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin
4LNP 1.41 Å, The first SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin
3RF3 1.61 Å, Shigella IpaA-VBS3 in complex with human vinculin
1YDI 1.8 Å, Human Vinculin Head Domain (VH1, 1-258) in Complex with Human Alpha-Actinin's…
3S90 1.97 Å, Human vinculin head domain Vh1 (residues 1-252) in complex with murine talin (VBS33;…
3MYI 2.2 Å, Human metavinculin tail domain
4DJ9 2.25 Å, Human vinculin head domain Vh1 (residues 1-258) in complex with the talin vinculin…
1RKE 2.35 Å, Human vinculin head (1-258) in complex with human vinculin tail (879-1066)
1SYQ 2.42 Å, Human vinculin head domain VH1, residues 1-258, in complex with human talin's vinculin…
5L0I 2.45 Å, Human metavinculin MVt R975W cardiomyopathy-associated mutant (residues 959-1134)
3VF0 2.54 Å, Raver1 in complex with metavinculin L954 deletion mutant
9QWO 2.54 Å, Vinculin tail bound to paxillin LD2

Browse structure collections

About this viewer

MolViewer shows 3TJ5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.