4LQQ: Serine/threonine-protein kinase CBK1

Crystal structure of the Cbk1(T743E)-Mob2 kinase-coactivator complex in crystal form B. Determined by X-ray diffraction at 3.6 Å resolution. Released 30 Jul 2014.

Method: X-ray diffraction
Resolution: 3.6 Å
Organism: Saccharomyces cerevisiae
Chains: 4
Atoms: 7,498
Mol. weight: 174.91 kDa
Ligands: ANP
Released: 30 Jul 2014

Explore 4LQQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LQQ contains 45 α-helices and 15 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	295-298	4
α-helix	299-316	18
α-helix	317-320	4
β-strand	352-360	9	1
β-strand	365-371	7	1
β-strand	378-384	7	1
β-strand	415-420	6	1
β-strand	424-429	6	1
β-strand	436	1	2
α-helix	437-443	7
α-helix	450-455	6
α-helix	458-468	11
α-helix	478-480	3
β-strand	482-483	2	2
β-strand	489-490	2	2
α-helix	557-560	4
α-helix	561-563	3
α-helix	590-606	17
α-helix	621-624	4
α-helix	627-629	3
α-helix	640-650	11
α-helix	679-681	3

Chain B: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	112-114	3
α-helix	116-117	2
α-helix	122-144	23
α-helix	183-193	11
α-helix	211-220	10
α-helix	223-228	6
α-helix	229-233	5
α-helix	234-240	7
α-helix	243-259	17
α-helix	272-275	4

Chain D: 13 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	297-299	3
α-helix	301-316	16
β-strand	352-357	6	3
β-strand	367-371	5	3
β-strand	378-382	5	3
α-helix	413-414	2
β-strand	415-419	5	3
β-strand	426-429	4	3
α-helix	437-443	7
α-helix	450-455	6
α-helix	458-468	11
β-strand	482-483	2	4
β-strand	489-490	2	4
α-helix	591-606	16
α-helix	616-618	3
α-helix	622-625	4
α-helix	627-629	3
α-helix	640-649	10
α-helix	666-668	3
α-helix	679-681	3

Chain E: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	116-117	2
α-helix	122-143	22
α-helix	187-193	7
α-helix	211-228	18
α-helix	229-233	5
α-helix	234-239	6
α-helix	243-259	17
α-helix	272-275	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase CBK1	A, D	protein	508	Saccharomyces cerevisiae	P53894 (AlphaFold model)
CBK1 kinase activator protein MOB2	B, E	protein	244	Saccharomyces cerevisiae	P43563 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>4LQQ_1 Serine/threonine-protein kinase CBK1 (chains A, D)
GSSPVQSGFNNGTISNYMYFERRPDLLTKGTQDKAAAVKLKIENFYQSSVKYAIERNERR
VELETELTSHNWSEERKSRQLSSLGKKESQFLRLRRTRLSLEDFHTVKVIGKGAFGEVRL
VQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDSPWVVSLYYSFQDAQYLYLI
MEFLPGGDLMTMLIRWQLFTEDVTRFYMAECILAIETIHKLGFIHRAIKPDNILIDIRGH
IKLSDFGLSTGFHKTHDSNYYKKLLQQDEATNGISKPGTYNANTTDTANKRQTMVVDSIS
LTMSNRQQIQTWRKSRRLMAYSTVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGW
PPFCSETPQETYRKIMNFEQTLQFPDDIHISYEAEDLIRRLLTHADQRLGRHGGADEIKS
HPFFRGVDWNTIRQVEAPYIPKLSSITDTRFFPTDELENVPDSPAMAQAAKQREQMTKQG
GSAPVKEDLPFIGYEYSRFDYLTRKNAL

Sequence of entity 2 (B, E), FASTA

>4LQQ_2 CBK1 kinase activator protein MOB2 (chains B, E)
GSRNKHHSPKRHSQTSFPAQKSTPQSQQLTSTTPQSQQQEASERSESQQIMFLSEPFVRT
ALVKGSFKTIVQLPKYVDLGEWIALNVFEFFTNLNQFYGVVAEYVTPDAYPTMNAGPHTD
YLWLDANNRQVSLPASQYIDLALTWINNKVNDKNLFPTKNGLPFPQQFSRDVQRIMVQMF
RIFAHIYHHHFDKIVHLSLEAHWNSFFSHFISFAKEFKIIDRKEMAPLLPLIESFEKQGK
IIYN

Ligands and cofactors

ID	Name	Formula	Copies
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	1

Primary citation

The Structure of an NDR/LATS Kinase-Mob Complex Reveals a Novel Kinase-Coactivator System and Substrate Docking Mechanism. Gogl, G., Schneider, K.D., Yeh, B.J. et al. PLoS Biol (2015) 13:e1002146-e1002146. DOI 10.1371/journal.pbio.1002146 · PubMed

Other PDB entries of the same protein (UniProt P53894 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6G85 1.53 Å, Structure of Cdc14 bound to CBK1 PxL motif
6G84 2.47 Å, Structure of Cdc14 bound to CBK1 PxL motif
5NCM 2.8 Å, Crystal structure Cbk1(NTR)-Mob2 complex
5NCL 3.15 Å, Crystal structure of the Cbk1-Mob2 kinase-coactivator complex with an SSD1 peptide
4LQS 3.3 Å, Crystal structure of the Cbk1-Mob2 kinase-coactivator complex
4LQP 4.5 Å, Crystal structure of the Cbk1(T743E)-Mob2 kinase-coactivator complex, in crystal form A

Browse structure collections

About this viewer

MolViewer shows 4LQQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.