Structure of Cdc14 bound to CBK1 PxL motif. Determined by X-ray diffraction at 1.53 Å resolution. Released 17 Oct 2018.
Explore 6G85 in 3D Show helices and sheets RCSB PDB PDBe
6G85 contains 43 α-helices and 26 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-5 | 3 | |
| β-strand | 10-14 | 5 | 1 |
| β-strand | 18-22 | 5 | 1 |
| α-helix | 27-29 | 3 | |
| β-strand | 33-36 | 4 | 1 |
| α-helix | 56-71 | 16 | |
| α-helix | 73-75 | 3 | |
| β-strand | 79-84 | 6 | 1 |
| α-helix | 88-105 | 18 | |
| α-helix | 110-114 | 5 | |
| α-helix | 115-117 | 3 | |
| α-helix | 123-126 | 4 | |
| β-strand | 127 | 1 | 2 |
| α-helix | 134-135 | 2 | |
| β-strand | 139 | 1 | 2 |
| α-helix | 141-153 | 13 | |
| α-helix | 164-171 | 8 | |
| α-helix | 173-175 | 3 | |
| β-strand | 178-180 | 3 | 3 |
| β-strand | 185-189 | 5 | 3 |
| α-helix | 190-191 | 2 | |
| α-helix | 209-220 | 12 | |
| β-strand | 223-228 | 6 | 3 |
| α-helix | 237-240 | 4 | |
| β-strand | 245-248 | 4 | 3 |
| α-helix | 255-258 | 4 | |
| α-helix | 259-274 | 16 | |
| β-strand | 278-283 | 6 | 3 |
| α-helix | 288-302 | 15 | |
| α-helix | 306-316 | 11 | |
| α-helix | 324-342 | 19 | |
| β-strand | 343-345 | 3 | 4 |
| α-helix | 351-353 | 3 | |
| β-strand | 359-361 | 3 | 4 |
| α-helix | 362-371 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-14 | 5 | 5 |
| β-strand | 18-22 | 5 | 5 |
| α-helix | 27-29 | 3 | |
| β-strand | 33-36 | 4 | 5 |
| α-helix | 56-71 | 16 | |
| α-helix | 73-75 | 3 | |
| β-strand | 79-84 | 6 | 5 |
| α-helix | 88-105 | 18 | |
| α-helix | 110-114 | 5 | |
| α-helix | 115-117 | 3 | |
| α-helix | 123-126 | 4 | |
| β-strand | 127 | 1 | 6 |
| α-helix | 134-135 | 2 | |
| β-strand | 139 | 1 | 6 |
| α-helix | 141-153 | 13 | |
| α-helix | 164-171 | 8 | |
| α-helix | 173-175 | 3 | |
| β-strand | 178-182 | 5 | 7 |
| β-strand | 185-189 | 5 | 7 |
| α-helix | 190-191 | 2 | |
| α-helix | 209-220 | 12 | |
| β-strand | 223-228 | 6 | 7 |
| α-helix | 237-240 | 4 | |
| β-strand | 245-248 | 4 | 7 |
| α-helix | 259-273 | 15 | |
| β-strand | 278-283 | 6 | 7 |
| α-helix | 288-302 | 15 | |
| α-helix | 306-316 | 11 | |
| α-helix | 324-342 | 19 | |
| β-strand | 343-345 | 3 | 8 |
| α-helix | 351-353 | 3 | |
| β-strand | 359-361 | 3 | 8 |
| α-helix | 362-368 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 89-92 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tyrosine-protein phosphatase CDC14 | A, B | protein | 374 | Saccharomyces cerevisiae S288c | Q00684 (AlphaFold model) |
| CBK1 | C | protein | 16 | Saccharomyces cerevisiae | P53894 (AlphaFold model) |
| CBK1 | D | protein | 17 | Saccharomyces cerevisiae | P53894 (AlphaFold model) |
>6G85_1 Tyrosine-protein phosphatase CDC14 (chains A, B) MRRSVYLDNTIEFLRGRVYLGAYDYTPEDTDELVFFTVEDAIFYNSFHLDFGPMNIGHLY RFAVIFHEILNDPENANKAVVFYSSASTRQRANAACMLCCYMILVQAWTPHQVLQPLAQV DPPFMPFRDAGYSNADFEITIQDVVYGVWRAKEKGLIDLHSFNLESYEKYEHVEFGDFNV LTPDFIAFASPQEDHPKGYLATKSSHLNQPFKSVLNFFANNNVQLVVRLNSHLYNKKHFE DIGIQHLDLIFEDGTCPDLSIVKNFVGAAETIIKRGGKIAVHCKAGLGRTGCLIGAHLIY TYGFTANECIGFLRFIRPGMVVGPQQHWLYLHQNDFREWKYTTRISLKPSEAIGGLYPLI SLEEYRLQKKKLKD
>6G85_2 CBK1 (chains C) FTDVPALNYPATPPPH
>6G85_3 CBK1 (chains D) AFTDVPALNYPATPPPH
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Water and common crystallization additives (PEG, EDO, GOL, MES) are not listed.
A PxL motif promotes timely cell cycle substrate dephosphorylation by the Cdc14 phosphatase. Kataria, M., Mouilleron, S., Seo, M.H. et al. Nat Struct Mol Biol (2018) 25:1093-1102. DOI 10.1038/s41594-018-0152-3 · PubMed
Other PDB entries of the same protein (UniProt Q00684 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6G85 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.