4LQS: Cbk1-Mob2 kinase-coactivator complex

Crystal structure of the Cbk1-Mob2 kinase-coactivator complex. Determined by X-ray diffraction at 3.3 Å resolution. Released 30 Jul 2014.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 4,061
Mol. weight: 87.68 kDa
Ligands: ANP
Released: 30 Jul 2014

Explore 4LQS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LQS contains 18 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	299-318	20
β-strand	339	1	1
β-strand	352-359	8	2
β-strand	366-371	6	2
β-strand	378-382	5	2
β-strand	415-420	6	2
β-strand	425-429	5	2
β-strand	436	1	3
α-helix	437-443	7
α-helix	450-455	6
α-helix	458-468	11
β-strand	482-483	2	3
β-strand	489-490	2	3
α-helix	557-560	4
α-helix	561-563	3
α-helix	591-606	16
α-helix	622-625	4
α-helix	640-649	10
α-helix	679-681	3

Chain B: 8 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	116-117	2
β-strand	120	1	1
α-helix	122-143	22
α-helix	183-192	10
α-helix	211-231	21
α-helix	234-237	4
α-helix	238-240	3
α-helix	243-259	17
α-helix	272-275	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase CBK1	A	protein	508	Saccharomyces cerevisiae	P53894 (AlphaFold model)
CBK1 kinase activator protein MOB2	B	protein	244	Saccharomyces cerevisiae	P43563 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4LQS_1 Serine/threonine-protein kinase CBK1 (chains A)
GSSPVQSGFNNGTISNYMYFERRPDLLTKGTQDKAAAVKLKIENFYQSSVKYAIERNERR
VELETELTSHNWSEERKSRQLSSLGKKESQFLRLRRTRLSLEDFHTVKVIGKGAFGEVRL
VQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDSPWVVSLYYSFQDAQYLYLI
MEFLPGGDLMTMLIRWQLFTEDVTRFYMAECILAIETIHKLGFIHRAIKPDNILIDIRGH
IKLSDFGLSTGFHKTHDSNYYKKLLQQDEATNGISKPGTYNANTTDTANKRQTMVVDSIS
LTMSNRQQIQTWRKSRRLMAYSTVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGW
PPFCSETPQETYRKIMNFEQTLQFPDDIHISYEAEDLIRRLLTHADQRLGRHGGADEIKS
HPFFRGVDWNTIRQVEAPYIPKLSSITDTRFFPTDELENVPDSPAMAQAAKQREQMTKQG
GSAPVKEDLPFIGYTYSRFDYLTRKNAL

Sequence of entity 2 (B), FASTA

>4LQS_2 CBK1 kinase activator protein MOB2 (chains B)
GSRNKHHSPKRHSQTSFPAQKSTPQSQQLTSTTPQSQQQEASERSESQQIMFLSEPFVRT
ALVKGSFKTIVQLPKYVDLGEWIALNVFEFFTNLNQFYGVVAEYVTPDAYPTMNAGPHTD
YLWLDANNRQVSLPASQYIDLALTWINNKVNDKNLFPTKNGLPFPQQFSRDVQRIMVQMF
RIFAHIYHHHFDKIVHLSLEAHWNSFFSHFISFAKEFKIIDRKEMAPLLPLIESFEKQGK
IIYN

Ligands and cofactors

ID	Name	Formula	Copies
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	1

Primary citation

The Structure of an NDR/LATS Kinase-Mob Complex Reveals a Novel Kinase-Coactivator System and Substrate Docking Mechanism. Gogl, G., Schneider, K.D., Yeh, B.J. et al. PLoS Biol (2015) 13:e1002146-e1002146. DOI 10.1371/journal.pbio.1002146 · PubMed

Other PDB entries of the same protein (UniProt P53894 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6G85 1.53 Å, Structure of Cdc14 bound to CBK1 PxL motif
6G84 2.47 Å, Structure of Cdc14 bound to CBK1 PxL motif
5NCM 2.8 Å, Crystal structure Cbk1(NTR)-Mob2 complex
5NCL 3.15 Å, Crystal structure of the Cbk1-Mob2 kinase-coactivator complex with an SSD1 peptide
4LQQ 3.6 Å, Crystal structure of the Cbk1(T743E)-Mob2 kinase-coactivator complex in crystal form B
4LQP 4.5 Å, Crystal structure of the Cbk1(T743E)-Mob2 kinase-coactivator complex, in crystal form A

Browse structure collections

About this viewer

MolViewer shows 4LQS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.