Crystal structure of Myo5a globular tail domain. Determined by X-ray diffraction at 1.87 Å resolution. Released 20 Nov 2013.
Explore 4LX1 in 3D Show helices and sheets RCSB PDB PDBe
4LX1 contains 48 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1475-1476 | 2 | 1 |
| α-helix | 1479-1481 | 3 | |
| α-helix | 1482-1486 | 5 | |
| α-helix | 1487-1491 | 5 | |
| α-helix | 1498-1502 | 5 | |
| α-helix | 1506-1520 | 15 | |
| α-helix | 1524-1544 | 21 | |
| α-helix | 1549-1568 | 20 | |
| α-helix | 1573-1575 | 3 | |
| α-helix | 1581-1584 | 4 | |
| β-strand | 1591 | 1 | 2 |
| α-helix | 1594-1624 | 31 | |
| α-helix | 1625-1629 | 5 | |
| α-helix | 1659-1675 | 17 | |
| α-helix | 1680-1704 | 25 | |
| α-helix | 1706-1708 | 3 | |
| α-helix | 1711-1730 | 20 | |
| α-helix | 1738-1741 | 4 | |
| α-helix | 1743-1753 | 11 | |
| α-helix | 1759-1768 | 10 | |
| α-helix | 1774-1783 | 10 | |
| α-helix | 1792-1795 | 4 | |
| α-helix | 1796-1805 | 10 | |
| β-strand | 1811 | 1 | 3 |
| α-helix | 1823-1825 | 3 | |
| α-helix | 1836-1838 | 3 | |
| α-helix | 1843-1845 | 3 | |
| β-strand | 1851-1852 | 2 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1475-1476 | 2 | 4 |
| α-helix | 1479-1481 | 3 | |
| α-helix | 1482-1486 | 5 | |
| α-helix | 1487-1491 | 5 | |
| α-helix | 1498-1502 | 5 | |
| α-helix | 1506-1520 | 15 | |
| α-helix | 1524-1545 | 22 | |
| α-helix | 1549-1568 | 20 | |
| α-helix | 1573-1575 | 3 | |
| α-helix | 1581-1584 | 4 | |
| β-strand | 1591 | 1 | 3 |
| α-helix | 1594-1624 | 31 | |
| α-helix | 1625-1629 | 5 | |
| α-helix | 1659-1675 | 17 | |
| α-helix | 1680-1704 | 25 | |
| α-helix | 1706-1708 | 3 | |
| α-helix | 1711-1730 | 20 | |
| α-helix | 1738-1741 | 4 | |
| α-helix | 1743-1753 | 11 | |
| α-helix | 1759-1768 | 10 | |
| α-helix | 1774-1783 | 10 | |
| α-helix | 1793-1795 | 3 | |
| α-helix | 1796-1805 | 10 | |
| β-strand | 1811 | 1 | 2 |
| α-helix | 1823-1825 | 3 | |
| α-helix | 1836-1838 | 3 | |
| α-helix | 1843-1845 | 3 | |
| β-strand | 1851-1852 | 2 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Unconventional myosin-Va | A, B | protein | 392 | Homo sapiens | Q9Y4I1 (AlphaFold model) |
>4LX1_1 Unconventional myosin-Va (chains A, B) VNIPRKEKDFQGMLEYKKEDEQKLVKNLILELKPRGVAVNLIPGLPAYILFMCVRHADYL NDDQKVRSLLTSTINSIKKVLKKRGDDFETVSFWLSNTCRFLHCLKQYSGEEGFMKHNTS RQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVRVLENILQPMIVSGMLEHETIQGVSGVKP TGLRKRTSSIADEGTYTLDSILRQLNSFHSVMCQHGMDPELIKQVVKQMFYIIGAITLNN LLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGAKETLEPLIQAAQLLQVKKKTDDD AEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMRLRDRKDSPQLLMDAKH IFPVTFPFNPSSLALETIQIPASLGLGFISRV
Structural basis of myosin V Rab GTPase-dependent cargo recognition. Pylypenko, O., Attanda, W., Gauquelin, C. et al. Proc Natl Acad Sci U S A (2013) 110:20443-20448. DOI 10.1073/pnas.1314329110 · PubMed
Other PDB entries of the same protein (UniProt Q9Y4I1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4LX1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.