4M0Q: Ebola virus VP24 structure

Ebola virus VP24 structure. Determined by X-ray diffraction at 1.92 Å resolution. Released 19 Mar 2014.

Method: X-ray diffraction
Resolution: 1.92 Å
Organism: Zaire ebolavirus
Chains: 2
Atoms: 3,703
Mol. weight: 51.84 kDa
Released: 19 Mar 2014

Explore 4M0Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4M0Q contains 23 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	16-26	11
β-strand	28	1	1
β-strand	30-33	4	2
β-strand	37-42	6	2
β-strand	45-50	6	2
α-helix	54-60	7
α-helix	70-74	5
α-helix	77-80	4
β-strand	85-87	3	3
α-helix	90-102	13
α-helix	103-107	5
α-helix	116-128	13
β-strand	133	1	1
α-helix	139-142	4
α-helix	147-165	19
α-helix	167-169	3
β-strand	178-182	5	3
β-strand	187-193	7	3
β-strand	196-202	7	3
α-helix	207-209	3
β-strand	217-222	6	3
α-helix	224-228	5

Chain B: 11 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	17-26	10
β-strand	28	1	4
β-strand	30-33	4	5
β-strand	37-42	6	5
β-strand	45-50	6	5
α-helix	54-60	7
α-helix	70-75	6
α-helix	77-80	4
β-strand	85-87	3	6
α-helix	90-104	15
α-helix	114-128	15
β-strand	133	1	4
α-helix	142-144	3
α-helix	147-165	19
α-helix	167-169	3
β-strand	178-182	5	6
β-strand	187-193	7	6
β-strand	196-202	7	6
α-helix	207-209	3
β-strand	217-222	6	6
α-helix	224-228	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Membrane-associated protein VP24	A, B	protein	230	Zaire ebolavirus	Q05322 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4M0Q_1 Membrane-associated protein VP24 (chains A, B)
GHMISPKKDLEKGVVLSDLCNFLVSQTIQGWKVYWAGIEFDVTHKGMALLHRLKTNDFAP
AWSMTRNLFPHLFQNPNSTIESPLWALRVILAAGIQDQLIDQSLIEPLAGALGLISDWLL
TTNTNHFNMRTQRVKEQLSLKMLSLIRSNILKFINKLDALHVVNYNGLLSSIEIGTQNHT
IIITRTNMGFLVELQEPDKSAMNRMKPGPAKFSLLHESTLKAFTQGSSTR

Primary citation

The Marburg Virus VP24 Protein Interacts with Keap1 to Activate the Cytoprotective Antioxidant Response Pathway. Edwards, M.R., Johnson, B., Mire, C.E. et al. Cell Rep (2014) 6:1017-1025. DOI 10.1016/j.celrep.2014.01.043 · PubMed

Other PDB entries of the same protein (UniProt Q05322 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4U2X 3.15 Å, Ebola virus VP24 in complex with Karyopherin alpha 5 C-terminus
8Y9J 4.6 Å, Structure of the Ebola virus nucleocapsid subunit
6EHM 7.3 Å, Model of the Ebola virus nucleocapsid subunit from recombinant virus-like particles
8UST 7.3 Å, In-virion structure of Ebola virus nucleocapsid-like assemblies from recombinant…
8USN 8.9 Å, Intracellular cryo-tomography structure of EBOV nucleocapsid at 8.9 Angstrom

Browse structure collections

About this viewer

MolViewer shows 4M0Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.