4M6B: Yeast Swr1-Z domain

Crystal structure of yeast Swr1-Z domain in complex with H2A.Z-H2B dimer. Determined by X-ray diffraction at 1.78 Å resolution. Released 19 Feb 2014.

Method: X-ray diffraction
Resolution: 1.78 Å
Organism: Saccharomyces cerevisiae
Chains: 4
Atoms: 3,398
Mol. weight: 54.35 kDa
Released: 19 Feb 2014

Explore 4M6B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4M6B contains 24 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	41-51	11
β-strand	56-57	2	1
β-strand	58	1	2
α-helix	59-86	28
β-strand	91-92	2	3
α-helix	94-104	11
α-helix	107-126	20
α-helix	133-137	5
α-helix	143-152	10
β-strand	159-160	2	3
α-helix	162-189	28
β-strand	194-195	2	1
α-helix	197-205	9
α-helix	208-220	13

Chains C and F: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	601-604	4
α-helix	620-621	2
β-strand	622	1	2
α-helix	623	1

Chain D: 9 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	41-51	11
β-strand	56-57	2	4
β-strand	58	1	5
α-helix	59-86	28
β-strand	91-92	2	6
α-helix	94-104	11
α-helix	107-126	20
α-helix	133-137	5
α-helix	143-151	9
β-strand	159-160	2	6
α-helix	162-189	28
β-strand	194-195	2	4
α-helix	197-205	9
α-helix	208-220	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chimera protein of Histone H2B.1 and Histone H2A.Z	A, D	protein	193	Saccharomyces cerevisiae	P02293 (AlphaFold model), Q12692 (AlphaFold model)
Helicase SWR1	C, F	protein	55	Saccharomyces cerevisiae	Q05471 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>4M6B_1 Chimera protein of Histone H2B.1 and Histone H2A.Z (chains A, D)
MRKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISA
REIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQAQSSSARAGLQFPVGRIKRYLKRHA
TGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLI
RATIASGGVLPHI

Sequence of entity 2 (C, F), FASTA

>4M6B_2 Helicase SWR1 (chains C, F)
GSHMDRESDDKTPSVGLSALFGKGEESDGDLDLDDSEDFTVNSSSVEGEELEKDW

Primary citation

The Catalytic Subunit of the SWR1 Remodeler Is a Histone Chaperone for the H2A.Z-H2B Dimer. Hong, J., Feng, H., Wang, F. et al. Mol Cell (2014) 53:498-505. DOI 10.1016/j.molcel.2014.01.010 · PubMed

Other PDB entries of the same protein (UniProt P02293 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6AE8 1.65 Å, Structure insight into histone chaperone Chz1-mediated H2A.Z recognition and replacement
4WNN 1.8 Å, SPT16-H2A-H2B FACT HISTONE Complex
7DLX 2.4 Å, crystal structure of H2AM4>Z-H2B
5BT1 2.62 Å, histone chaperone Hif1 playing with histone H2A-H2B dimer
9C9G 2.91 Å, S.c INO80 in complex with S.c 0/80 nucleosome
9C9S 3.09 Å, S.c INO80 in complex with S.c 0/40 nucleosome, Class 1
7K78 3.1 Å, antibody and nucleosome complex
9C9T 3.16 Å, S.c INO80 in complex with S.c 0/40 nucleosome, Class 2
7SSA 3.2 Å, Cryo-EM structure of pioneer factor Cbf1 bound to the nucleosome
9OB1 3.2 Å, S.c INO80 in complex with Yeast 0/80 nucleosome, Apo State
4KUD 3.2 Å, Crystal structure of N-terminal acetylated Sir3 BAH domain D205N mutant in complex with…
7ON1 3.35 Å, Cenp-A nucleosome in complex with Cenp-C

Browse structure collections

About this viewer

MolViewer shows 4M6B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.