Crystal structure of PDE5 in complex with inhibitor 5R. Determined by X-ray diffraction at 2.0 Å resolution. Released 9 Jul 2014.
Explore 4MD6 in 3D Show helices and sheets RCSB PDB PDBe
4MD6 contains 21 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 536-545 | 10 | |
| α-helix | 551-554 | 4 | |
| α-helix | 568-581 | 14 | |
| α-helix | 584-587 | 4 | |
| α-helix | 592-604 | 13 | |
| α-helix | 615-630 | 16 | |
| α-helix | 635-637 | 3 | |
| α-helix | 640-652 | 13 | |
| α-helix | 660-662 | 3 | |
| α-helix | 680-693 | 14 | |
| α-helix | 706-722 | 17 | |
| α-helix | 725-740 | 16 | |
| α-helix | 749-764 | 16 | |
| α-helix | 766-769 | 4 | |
| α-helix | 772-786 | 15 | |
| α-helix | 809-811 | 3 | |
| α-helix | 813-820 | 8 | |
| α-helix | 821-825 | 5 | |
| α-helix | 826-835 | 10 | |
| α-helix | 837-839 | 3 | |
| α-helix | 840-857 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| cGMP-specific 3',5'-cyclic phosphodiesterase | A | protein | 326 | Homo sapiens | O76074 (AlphaFold model) |
>4MD6_1 cGMP-specific 3',5'-cyclic phosphodiesterase (chains A) EETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEV LCRWILSVKKNYRKNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEILALLIAALSHD LDHRGVNNSYIQRSEHPLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLK IIKQAILATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFLAMLMTACDLSAITKPWPI QQRIAELVATEFFDQGDRERKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYEALTH VSEDCFPLLDGCRKNRQKWQALAEQQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 1 |
| ZN | Zinc ion | Zn | 1 |
| 24E | 3-(4-hydroxybenzyl)-1-(thiophen-2-yl)chromeno[2,3-c]pyrrol-9(2H)-one | C22 H15 N O3 S | 1 |
Water and common crystallization additives (SO4) are not listed.
Discovery of 3-(4-hydroxybenzyl)-1-(thiophen-2-yl)chromeno[2,3-c]pyrrol-9(2H)-one as a phosphodiesterase-5 inhibitor and its complex crystal structure. Shang, N.N., Shao, Y.X., Cai, Y.H. et al. Biochem Pharmacol (2014) 89:86-98. DOI 10.1016/j.bcp.2014.02.013 · PubMed
Other PDB entries of the same protein (UniProt O76074 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4MD6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.