4MI8: Bcl-2 homolog

Crystal structure of the complex of murine gamma-herpesvirus 68 Bcl-2 homolog M11 and a Beclin 1 BH3 domain-derived peptide. Determined by X-ray diffraction at 2.1 Å resolution. Released 29 Jan 2014.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Murid herpesvirus 4, Homo sapiens
Chains: 4
Atoms: 2,695
Mol. weight: 39.38 kDa
Released: 29 Jan 2014

Explore 4MI8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4MI8 contains 22 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
α-helix	7-22	16
α-helix	27-29	3
α-helix	32-55	24
α-helix	64-66	3
α-helix	67-80	14
α-helix	85-97	13
α-helix	98-102	5
α-helix	104	1
α-helix	110-125	16
α-helix	128-131	4
β-strand	134	1	1

Chain B: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	2
α-helix	7-22	16
α-helix	27-29	3
α-helix	32-55	24
α-helix	61-64	4
α-helix	67-78	12
α-helix	85-97	13
α-helix	98-102	5
α-helix	104	1
α-helix	110-125	16
α-helix	128-131	4
β-strand	134	1	2

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	109-123	15

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	108-123	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bcl-2 homolog (Gene 16?)	A, B	protein	143	Murid herpesvirus 4	P89884 (AlphaFold model)
Beclin-1	C, D	protein	26	Homo sapiens	Q14457 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4MI8_1 Bcl-2 homolog (Gene 16?) (chains A, B)
MASHKKSGTYWATLITAFLKTVSKVEELDCVDSAVLVDVSKIITLTQEFRRHYDSVYRAD
YGPALKNWKRDLSKLFTSLFVDVINSGRIVGFFDVGRYVCEEVLCPGSWTEDHELLNDCM
THFFIENNLMNHFPLEDHHHHHH

Sequence of entity 2 (C, D), FASTA

>4MI8_2 Beclin-1 (chains C, D)
GSGTMENLSRRLKVTEALFDIMSGQT

Primary citation

Targeting gamma-herpesvirus 68 Bcl-2-mediated down-regulation of autophagy. Su, M., Mei, Y., Sanishvili, R. et al. J Biol Chem (2014) 289:8029-8040. DOI 10.1074/jbc.M113.515361 · PubMed

Other PDB entries of the same protein (UniProt P89884 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BL2 2.3 Å, Crystal Structure of M11, the BCL-2 Homolog of Murine Gamma-herpesvirus 68, Complexed…
3DVU 2.5 Å, Crystal structure of the complex of murine gamma-herpesvirus 68 Bcl-2 homolog M11 and…
2ABO NMR structure of gamma herpesvirus 68 a viral Bcl-2 homolog

Browse structure collections

About this viewer

MolViewer shows 4MI8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.